Tolypothrix tenuis: NIES37_53540 Help Entry NIES37_53540      CDS       T10359                                  Symbol psaE Name (GenBank) photosystem I protein E   KO K02693   photosystem I subunit IV Organism ttq  Tolypothrix tenuis Pathway ttq00195   Photosynthesis ttq01100   Metabolic pathways Module ttq_M00163   Photosystem I ttq_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:ttq00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     NIES37_53540 (psaE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:ttq00194]     NIES37_53540 (psaE) Photosynthesis proteins [BR:ttq00194]  Photosystem and electron transport system   Photosystem I (P700 chlorophyll a) [OT]    Main subunits     NIES37_53540 (psaE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PSI_PsaE Motif Other DBs NCBI-ProteinID:  BAZ01355 UniProt:  A0A1Z4N6M2 LinkDB All DBs Position complement(6794100..6794312) Genome browser AA seq 70 aa AA seqDB search MVQRGSKVRILRPESYWFQDVGTVASIDQSGIKYSVIVRFDNVNYSGINTNNFAESELLE VAPPAAKAKK NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggttcaacgtggttctaaagtacgtattctcagaccagagtcctactggtttcaagat gtaggtaccgtagcgtctattgaccaaagcggtatcaagtattctgtgattgtccgtttt gacaatgtcaattactcagggatcaacaccaataactttgctgaaagcgaattattggaa gttgcacctccagcagcaaaagctaaaaagtaa

DBGET integrated database retrieval system