Tolypothrix tenuis: NIES37_69640 Help Entry NIES37_69640      CDS       T10359                                  Name (GenBank) Rieske (2Fe-2S) region   KO K02636   cytochrome b6-f complex iron-sulfur subunit [EC:7.1.1.6] Organism ttq  Tolypothrix tenuis Pathway ttq00195   Photosynthesis ttq01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:ttq00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     NIES37_69640  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:ttq00194]     NIES37_69640 Enzymes [BR:ttq01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.6  plastoquinol---plastocyanin reductase      NIES37_69640 Photosynthesis proteins [BR:ttq00194]  Photosystem and electron transport system   Cytochrome b6/f complex [OT]    NIES37_69640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rieske Motif Other DBs NCBI-ProteinID:  BAZ02951 UniProt:  A0A1Z4NB51 LinkDB All DBs Position plasmid1:131030..131275 Genome browser AA seq 81 aa AA seqDB search MRQKALICSHDEHGKVLTDKVLIVRNTANKKLVAVSPLCAHKNCVVDWKQDKQRFVCPYH GSEFGTDGKVVNGPAASRTRT NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcggcaaaaggcattaatctgttcgcacgatgaacatggtaaggtgttgactgataaa gttctgattgtgcgaaataccgccaataagaaattagttgctgtcagtccactatgtgct cataaaaattgcgtcgttgattggaaacaagacaagcagcgttttgtttgcccatatcat ggttctgaatttggtactgacggcaaagtggtgaatgggccagcggccagcagaacgcgg acttaa

DBGET integrated database retrieval system