Thermobaculum terrenum: Tter_1641 Help Entry Tter_1641         CDS       T01134                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ttr  Thermobaculum terrenum Pathway ttr01100   Metabolic pathways ttr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ttr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Tter_1641    00074 Mycolic acid biosynthesis     Tter_1641   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Tter_1641 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N PP-binding_2 DUF5798 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ACZ42547 UniProt:  D1CCN2 LinkDB All DBs Position 1:complement(1775647..1775895) Genome browser AA seq 82 aa AA seqDB search MQEETYAKLKAMVADRLHVPEDQITPEASFVEDLNADSLEVVELVMALEDEFGISIPDED AEKIVTVQDALNYIEQHAGSNS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt gtgcaagaggaaacctatgcaaagctaaaggcaatggtcgcagataggcttcatgtaccc gaagaccaaattacaccggaagcctcgttcgtagaggatctaaatgctgattctcttgaa gttgttgaacttgttatggcgctggaagacgaattcgggatcagcatacctgatgaggat gccgagaagatcgtaactgttcaggatgctcttaactacattgagcagcatgctggcagt aattcatag

DBGET integrated database retrieval system