Teredinibacter turnerae: TERTU_2373 Help Entry TERTU_2373        CDS       T00952                                  Name (GenBank) acyl carrier protein ACP   KO K02078   acyl carrier protein Organism ttu  Teredinibacter turnerae Pathway ttu01100   Metabolic pathways ttu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ttu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TERTU_2373    00074 Mycolic acid biosynthesis     TERTU_2373   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TERTU_2373 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  ACR13454 UniProt:  C5BKB3 LinkDB All DBs Position complement(2623511..2623741) Genome browser AA seq 76 aa AA seqDB search MSMHDQLAALIESLLDIDMEELTADSHFKDLPGWDSVNAMRLIAHIETEFAIKLPIKEYL KAETLADVQTLIARAA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgtctatgcatgaccagttggcggctctgattgagtctttgttggatatcgatatggag gagttgacggctgattctcattttaaggatctaccgggttgggattctgtcaatgccatg cgcctgattgcgcacatagagacggaatttgctatcaagctaccaatcaaggaatacctt aaagccgaaactctggcggatgttcaaacactgatcgcaagagcggcgtaa

DBGET integrated database retrieval system