Tepidimonas taiwanensis: LCC91_05515
Help
Entry
LCC91_05515 CDS
T07546
Symbol
accC
Name
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
KO
K01965
propionyl-CoA carboxylase alpha subunit [EC:
6.4.1.3
]
Organism
ttw
Tepidimonas taiwanensis
Pathway
ttw00280
Valine, leucine and isoleucine degradation
ttw00630
Glyoxylate and dicarboxylate metabolism
ttw00640
Propanoate metabolism
ttw01100
Metabolic pathways
ttw01110
Biosynthesis of secondary metabolites
ttw01120
Microbial metabolism in diverse environments
ttw01200
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:
ttw00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00630 Glyoxylate and dicarboxylate metabolism
LCC91_05515 (accC)
00640 Propanoate metabolism
LCC91_05515 (accC)
09105 Amino acid metabolism
00280 Valine, leucine and isoleucine degradation
LCC91_05515 (accC)
Enzymes [BR:
ttw01000
]
6. Ligases
6.4 Forming carbon-carbon bonds
6.4.1 Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
6.4.1.3 propionyl-CoA carboxylase
LCC91_05515 (accC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CPSase_L_D2
Biotin_carb_N
Biotin_carb_C
PCC_BT
Biotin_lipoyl
Dala_Dala_lig_C
ATP-grasp
HlyD_3
GARS_A
ATP-grasp_3
ATP-grasp_5
GCV_H
Biotin_lipoyl_2
ATPgrasp_ST
RnfC_N
Motif
Other DBs
NCBI-ProteinID:
UBQ06536
LinkDB
All DBs
Position
complement(1188335..1190386)
Genome browser
AA seq
683 aa
AA seq
DB search
MFKKILIANRGEIACRVIATARKMGIATVAVYSEADREARHVRLADEAVLLGPAPSRESY
LVADKIIAAAKATGAEAIHPGYGFLSENEDFARRVEEEGLVFIGPKHHSIAAMGDKIASK
KLAKEAGVNTIPGWNDPIDTPEQAVEIARNIGYPVMIKASAGGGGKGLRVAWNDKEAFDG
FTSCRNEARNSFGDDRVFIEKFVEEPRHIEIQVLGDAYGNVIYLNERECSIQRRHQKVIE
EAPSPFISDATRRAMGEQAVALAKAVQYQSAGTVEFVVGKDQSFYFLEMNTRLQVEHPVT
ECITGLDLVELMIRIAAGEKLPLTQADVKREGWAIECRINAEDPFRNFLPSTGRLVYFRP
PKETMWQADTAHRYGVRVDTGVFEGGEIPMYYDSMIAKLIVHGKDRADAIAKMREALNGF
VIRGINSNIPFQAALLAHPDFVAGRFNTGFIAQHYASGFRAEDVPHDDEAFLVALAAFVR
RKSRERAAAISGQLPGYGVKVGKDYTVIRLAADGQHGYIPVHVDEFVGETGYASVTVGDK
RYKITSPSRLSDIVITGEVNGQPFTAQVERGSPKNPLALVVQHNGTRLECLVVSPRMAEL
YRLMPFKAPPDMSRYVLSPMPGLLVDVAVQPGQKVQAGERVAVIEAMKMENVLFAPADGV
VAKVLAQKGESLVVDQPIVEFER
NT seq
2052 nt
NT seq
+upstream
nt +downstream
nt
atgttcaagaaaatcctgattgccaaccgcggcgaaatcgcgtgccgcgtcatcgctacc
gcgcgcaagatgggcatcgccaccgtggcggtgtattccgaggccgatcgcgaggcccgc
catgtacggctggcggacgaagcggtgttgctggggccggccccgagccgggagtcgtac
ctggtcgccgacaagatcatcgccgccgccaaggccaccggggccgaggccatccacccg
ggctatgggttcctgtccgaaaacgaggacttcgcccgccgggtggaggaggaggggctg
gtcttcatcggcccgaagcaccactcgatcgcggcgatgggcgacaagatcgcctccaag
aagctggccaaagaggccggcgtcaacaccatccccggctggaacgaccccatcgacacg
ccggagcaggcggtggaaatcgcccgcaacatcggctacccggtcatgatcaaggccagc
gccggcggcggcggcaaggggctgcgcgtggcctggaacgacaaggaggcgttcgacggc
ttcacctcctgccgcaacgaggcgcgcaacagcttcggcgacgaccgcgtgttcatcgag
aagttcgtcgaggagccgcgccacatcgaaatccaggtgctcggtgacgcctatggcaac
gtcatctacctcaacgagcgcgagtgctcgatccagcgccgccaccagaaggtgatcgag
gaggcgccgtcgcccttcatcagcgacgccacccggcgcgcgatgggcgagcaggcggtg
gcgctggcaaaggccgtgcagtaccagagcgccggcaccgtggagttcgtggtcggcaag
gaccagagcttctacttcctggaaatgaacacccggctgcaggtggagcacccggtgacg
gagtgcatcaccgggctggacctggtcgagctgatgatccgcatcgccgcgggggaaaag
ctgccgctgacgcaggcggacgtcaagcgcgagggctgggcgatcgagtgccgcatcaac
gcggaggatccgtttcgcaacttcctgccctccaccggacgcctggtgtacttccgcccg
cccaaggagacgatgtggcaggccgacaccgcgcaccgctacggcgtgcgcgtggacacc
ggcgtgttcgagggcggcgagatcccgatgtactacgactcgatgatcgccaagctcatc
gtgcacggcaaggaccgcgctgacgccattgccaagatgcgcgaggcgctcaacggcttc
gtcatccgtggcatcaacagcaacatcccgttccaggccgcgctgctggcacacccggac
ttcgtcgccgggcgcttcaacaccggcttcattgcccagcattacgccagtggctttcgc
gccgaggatgtgccgcacgacgacgaggcctttctggtggcgctggcggccttcgtgcgg
cgcaagtcgcgcgagcgtgccgccgccatcagcggccagctcccggggtacggcgtcaag
gtgggcaaggactacacggtcatccgcctcgcggccgacgggcagcacggctacatcccc
gtgcacgtggacgagttcgtcggcgagaccggctacgcttcggtgacggtcggcgacaag
cgctacaagatcacctcgccctcgcgcctgagcgatatcgtcatcaccggcgaggtcaat
ggccagcccttcaccgcgcaggtcgagcgcggcagccccaagaacccgctggcgctggtg
gtgcagcacaatggcacccggctcgaatgcctggtggtgtcgccgcgcatggcagagctg
taccgcctgatgcccttcaaggcgccgccggacatgagccgctatgtgctctcgccgatg
ccggggctgctggtggacgtggcggtgcagcccggccagaaggtgcaggccggcgagcgg
gtggcggtcatcgaggcgatgaagatggaaaacgtcctctttgcgccggccgatggcgtc
gtggccaaggtgctcgcgcagaagggcgagtcgctggtggtcgatcagccaatcgtggag
ttcgagcgatga
DBGET
integrated database retrieval system