KEGG   Triticum urartu (red wild einkorn wheat): 125514280
Entry
125514280         CDS       T08232                                 
Name
(RefSeq) tubby-like F-box protein 5
  KO
K19600  tubby and related proteins
Organism
tua  Triticum urartu (red wild einkorn wheat)
Brite
KEGG Orthology (KO) [BR:tua00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:tua03037]
    125514280
   04990 Domain-containing proteins not elsewhere classified [BR:tua04990]
    125514280
Cilium and associated proteins [BR:tua03037]
 Primary cilia and associated proteins
  Other primary cilia associated proteins
   125514280
Domain-containing proteins not elsewhere classified [BR:tua04990]
 Other domain-containing proteins
  Tubby family proteins
   125514280
SSDB
Motif
Pfam: Tub F-box-like F-box DUF3527
Other DBs
NCBI-GeneID: 125514280
NCBI-ProteinID: XP_048535548
UniProt: A0A8R7UXL5
LinkDB
Position
6:468973827..468977000
AA seq 429 aa
MSLKSIVRELKEMRDGIGSMSRRGGVTDGRAGHGHGRGGSRHSWPSLWPEPQPQPPRPGQ
EPQQQGQWANLPPELLIDVIQRVEASEVAWPARRHVVACAAVCRSWREVTKDVVKTLEEC
SRITFPISLKQPGPRDSPVQCFVRRDRATSTYLLYLGLSPSLHGENDKLLLAARKIRRAA
RTSFVISLMSDDFSHSSSTYVGKLKPNFLGTKFTIFDSQPPCDAAVLPNNKPSKRHSKQV
SPRLPLGNYNVATVSYELTVLRNRGPRRMQCTMHSIPAVCIQEGGKAPTPTGMVHSLDEQ
VSTLSTSGKGKVPNIEFSSTSLSADLSGPISTSEAPLLLKNKAPRWHEQLQCWCLNFRGR
VTVASVKNFQLVASVDPSLGVPAAEQEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLT
SFDTKPACE
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgtctttgaagagcatcgtgcgggagctcaaggagatgagggacggcatcgggagcatg
tccaggcgcggcggcgtcaccgacgggcgcgccggccacggccacggccgcggggggtcg
cggcattcttggcccagcctgtggccggagccccagccgcagccgccgcggccgggccag
gagccgcagcagcaggggcagtgggcgaacctgccgccggagctgctcatcgacgtgata
cagagggtggaggccagcgaggtggcctggccggcgcggcgccacgtcgttgcctgcgcc
gccgtctgccggtcgtggcgcgaggtcaccaaggatgtggtgaagaccctcgaggagtgc
agcaggatcaccttccccatctccctaaagcagccggggcctcgtgattctccggtgcag
tgctttgtgaggagggacagggcgacgtccacctatctcctctacttggggctcagccca
tctctgcatggggaaaatgacaagcttttgcttgcggcccgcaagatcagacgtgcagcc
agaacttcttttgtgatatcactcatgtctgatgatttttctcattccagcagcacctat
gttggcaaactgaaaccaaacttccttggcacaaagttcacaatatttgatagccaacct
ccttgtgatgctgcggtgttgcctaacaacaagccaagcaaaaggcactcgaagcaagta
tcaccaagactgccactaggcaattacaatgttgcgaccgtctcatatgagctcactgtc
ctgcgcaatcgaggaccaaggagaatgcagtgcaccatgcactcgataccagccgtgtgc
attcaggaaggtggcaaggccccgacccctactggcatggtccactcactcgacgaacaa
gtgtctaccttatcaactagtggcaaaggaaaggtaccaaacatcgaattctcgtcaaca
agcctcagcgctgatttatccggaccgatctccaccagcgaagcgcctctgcttctgaag
aataaagctccccgctggcacgagcagctgcagtgctggtgcctcaacttccgagggcgt
gtcaccgtagcatcggtcaagaacttccagctcgttgcctcggttgacccctccctgggc
gtcccagcggcggagcaggaaaaggtgatcctccagtttgggaagatcgggaaagacata
ttcacaatggattatagatacccgctgtcggcgttccaggcctttgcgatctgcctgact
agcttcgacacgaaaccggcctgcgaatag

DBGET integrated database retrieval system