Triticum urartu (red wild einkorn wheat): 125514280
Help
Entry
125514280 CDS
T08232
Name
(RefSeq) tubby-like F-box protein 5
KO
K19600
tubby and related proteins
Organism
tua
Triticum urartu (red wild einkorn wheat)
Brite
KEGG Orthology (KO) [BR:
tua00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
03037 Cilium and associated proteins [BR:
tua03037
]
125514280
04990 Domain-containing proteins not elsewhere classified [BR:
tua04990
]
125514280
Cilium and associated proteins [BR:
tua03037
]
Primary cilia and associated proteins
Other primary cilia associated proteins
125514280
Domain-containing proteins not elsewhere classified [BR:
tua04990
]
Other domain-containing proteins
Tubby family proteins
125514280
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Tub
F-box-like
F-box
DUF3527
Motif
Other DBs
NCBI-GeneID:
125514280
NCBI-ProteinID:
XP_048535548
UniProt:
A0A8R7UXL5
LinkDB
All DBs
Position
6:468973827..468977000
Genome browser
AA seq
429 aa
AA seq
DB search
MSLKSIVRELKEMRDGIGSMSRRGGVTDGRAGHGHGRGGSRHSWPSLWPEPQPQPPRPGQ
EPQQQGQWANLPPELLIDVIQRVEASEVAWPARRHVVACAAVCRSWREVTKDVVKTLEEC
SRITFPISLKQPGPRDSPVQCFVRRDRATSTYLLYLGLSPSLHGENDKLLLAARKIRRAA
RTSFVISLMSDDFSHSSSTYVGKLKPNFLGTKFTIFDSQPPCDAAVLPNNKPSKRHSKQV
SPRLPLGNYNVATVSYELTVLRNRGPRRMQCTMHSIPAVCIQEGGKAPTPTGMVHSLDEQ
VSTLSTSGKGKVPNIEFSSTSLSADLSGPISTSEAPLLLKNKAPRWHEQLQCWCLNFRGR
VTVASVKNFQLVASVDPSLGVPAAEQEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLT
SFDTKPACE
NT seq
1290 nt
NT seq
+upstream
nt +downstream
nt
atgtctttgaagagcatcgtgcgggagctcaaggagatgagggacggcatcgggagcatg
tccaggcgcggcggcgtcaccgacgggcgcgccggccacggccacggccgcggggggtcg
cggcattcttggcccagcctgtggccggagccccagccgcagccgccgcggccgggccag
gagccgcagcagcaggggcagtgggcgaacctgccgccggagctgctcatcgacgtgata
cagagggtggaggccagcgaggtggcctggccggcgcggcgccacgtcgttgcctgcgcc
gccgtctgccggtcgtggcgcgaggtcaccaaggatgtggtgaagaccctcgaggagtgc
agcaggatcaccttccccatctccctaaagcagccggggcctcgtgattctccggtgcag
tgctttgtgaggagggacagggcgacgtccacctatctcctctacttggggctcagccca
tctctgcatggggaaaatgacaagcttttgcttgcggcccgcaagatcagacgtgcagcc
agaacttcttttgtgatatcactcatgtctgatgatttttctcattccagcagcacctat
gttggcaaactgaaaccaaacttccttggcacaaagttcacaatatttgatagccaacct
ccttgtgatgctgcggtgttgcctaacaacaagccaagcaaaaggcactcgaagcaagta
tcaccaagactgccactaggcaattacaatgttgcgaccgtctcatatgagctcactgtc
ctgcgcaatcgaggaccaaggagaatgcagtgcaccatgcactcgataccagccgtgtgc
attcaggaaggtggcaaggccccgacccctactggcatggtccactcactcgacgaacaa
gtgtctaccttatcaactagtggcaaaggaaaggtaccaaacatcgaattctcgtcaaca
agcctcagcgctgatttatccggaccgatctccaccagcgaagcgcctctgcttctgaag
aataaagctccccgctggcacgagcagctgcagtgctggtgcctcaacttccgagggcgt
gtcaccgtagcatcggtcaagaacttccagctcgttgcctcggttgacccctccctgggc
gtcccagcggcggagcaggaaaaggtgatcctccagtttgggaagatcgggaaagacata
ttcacaatggattatagatacccgctgtcggcgttccaggcctttgcgatctgcctgact
agcttcgacacgaaaccggcctgcgaatag
DBGET
integrated database retrieval system