KEGG   Triticum urartu (red wild einkorn wheat): 125522030
Entry
125522030         CDS       T08232                                 
Name
(RefSeq) aspartate aminotransferase, mitochondrial
  KO
K14455  aspartate aminotransferase, mitochondrial [EC:2.6.1.1]
Organism
tua  Triticum urartu (red wild einkorn wheat)
Pathway
tua00220  Arginine biosynthesis
tua00250  Alanine, aspartate and glutamate metabolism
tua00270  Cysteine and methionine metabolism
tua00330  Arginine and proline metabolism
tua00350  Tyrosine metabolism
tua00360  Phenylalanine metabolism
tua00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tua00710  Carbon fixation by Calvin cycle
tua00950  Isoquinoline alkaloid biosynthesis
tua00960  Tropane, piperidine and pyridine alkaloid biosynthesis
tua01100  Metabolic pathways
tua01110  Biosynthesis of secondary metabolites
tua01200  Carbon metabolism
tua01210  2-Oxocarboxylic acid metabolism
tua01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tua00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation by Calvin cycle
    125522030
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    125522030
   00270 Cysteine and methionine metabolism
    125522030
   00220 Arginine biosynthesis
    125522030
   00330 Arginine and proline metabolism
    125522030
   00350 Tyrosine metabolism
    125522030
   00360 Phenylalanine metabolism
    125522030
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    125522030
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    125522030
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    125522030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tua01007]
    125522030
Enzymes [BR:tua01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     125522030
Amino acid related enzymes [BR:tua01007]
 Aminotransferase (transaminase)
  Class I
   125522030
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 125522030
NCBI-ProteinID: XP_048543052
LinkDB
Position
7:complement(508561480..508565716)
AA seq 498 aa
MFHVARAAAHDIIEVLAQQTPEEHKAPVQNNIAARNTPAAAKHRVPRRFLRTQVTCHLLP
SSGKLATARSDGMAMSRAAAAVGRHRCGPRLPAARSMASWFGHVEPAAKDPILGVTEAFL
ADPSPDKVNVGVGAYRDDDGKPVVLECVREAERRIAGSTNMEYLPMGGSVKMIEESLKLA
YGEDSEFIKDKRIAAVQALSGTGACRLFADFQKRFLPDSQIYIPTPTWSNHHNIWRDAQV
PQRTFAYYHPESRGLDFAGLMDDIKNAPEGSFFLLHACAHNPTGVDPSEEQWREISQQFK
VKNHFPFFDMAYQGFASGDPERDAKAIRIFLEDGHQIGCAQSYAKNMGLYGQRAGCLSIL
CDDEIQAVDVKSQLQQIARPMYSNPPLHGALIVSTILGDPALKSLWLKEVKGMADRIIGM
RKALKESLEKLGSPLSWEHITNQIGMFCYSGMTPEQVDRLTNEFHIYMTRNGRISMAGVT
TGNVAYLANAIHEVTKPN
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgttccacgtggcacgtgcggccgcgcatgatatcattgaagtactggcacagcaaact
ccggaagagcacaaggccccagtacagaacaacatagcggcacgcaacacgccagccgca
gcaaagcaccgggtgccgcgccgcttcctcaggacccaagtcacctgccatctcctcccc
agcagcggcaaactcgccaccgcacgcagcgacggcatggcgatgtctcgcgccgcggca
gcggtcgggcggcaccggtgcgggccgcgcctgcccgcggcgaggtccatggcgtcgtgg
ttcggccacgtggagccggccgccaaggaccccatcctcggcgtcaccgaggccttcctc
gccgacccctcgccggacaaagtgaacgtcggcgtcggtgcgtaccgggacgacgacggg
aagcccgtggtgctcgagtgcgtgcgcgaggcggagcggcgcatcgccgggagcaccaac
atggagtaccttccaatgggaggaagcgtgaagatgatcgaggagtcgctgaagctggca
tacggggaggattctgagttcatcaaggacaagaggattgcggcagtgcaggctctttca
gggactggtgcatgtcgcctctttgcagatttccagaaacgcttcttgccggattcacag
atctacatacctacgcctacatggtcaaaccatcacaacatttggagggatgcccaggta
ccacaaagaacatttgcctactaccacccggaatcaagaggactggactttgcaggccta
atggatgatatcaagaacgctccagagggttccttctttttgcttcatgcatgtgctcac
aatcccactggggtcgatccttctgaggaacagtggagagagatatctcaacaattcaag
gtgaagaaccatttcccatttttcgacatggcataccaaggatttgccagtggtgaccca
gagagagatgccaaggcaattcggatctttctcgaagatggacatcaaattggatgtgca
cagtcatatgcaaaaaacatgggactttatggccaaagagcaggatgccttagtattctc
tgcgacgatgaaatacaagcagttgatgtgaagagccagttacaacagattgccagacct
atgtacagcaacccaccccttcacggcgcactaattgtttccactatccttggtgatcca
gcactgaaaagcttatggctgaaagaggtcaagggtatggctgatcgcattattggaatg
cgaaaagcacttaaggagagccttgaaaagttgggttcaccattatcatgggaacatatt
actaatcagattggcatgttttgctacagcgggatgacacctgaacaagttgatcgctta
acaaatgaatttcacatatacatgactcgtaatggcaggataagcatggctggtgtaaca
acaggaaatgtcgcatatttggctaacgctattcatgaggtcactaagccaaattaa

DBGET integrated database retrieval system