KEGG   Triticum urartu (red wild einkorn wheat): 125522205
Entry
125522205         CDS       T08232                                 
Name
(RefSeq) protein DETOXIFICATION 16-like
  KO
K03327  MATE family, multidrug and toxin extrusion protein
Organism
tua  Triticum urartu (red wild einkorn wheat)
Brite
KEGG Orthology (KO) [BR:tua00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tua02000]
    125522205
Transporters [BR:tua02000]
 Solute carrier family (SLC)
  SLC47: Multidrug and Toxin Extrusion (MATE) family
   125522205
SSDB
Motif
Pfam: MatE
Other DBs
NCBI-GeneID: 125522205
NCBI-ProteinID: XP_048543249
LinkDB
Position
7:complement(14728928..14731779)
AA seq 475 aa
MDHKQDTEPLLPAADEWCRQGLAAAEAKRLVRLAGPMITSCLLQNIINIMSLMFVGHLGE
LPLAGASLANSVASVTGFSIIIGMATALDTLCGQAYGARQHHLLGVYKQRAMVVLGLTCV
PIAVVWAHTGRILVLLGQDPRIAAEAGAYARWLIPSLAVSVPLQCHVRFLQAQSLVLPVT
ASSAAAALCHLAVCWALVFKAGMGAKGAALSNAISYAVNLVMLSLYVRLSSSCRDTWNGF
SMEGFKDLRKFADLAVPSAMMICLEWWAFETLVLLSGLLPNPQLETSVLSICLNTGILLF
MIPSGLGYSVSTRVSNELGAGQPQAAKLATRVVVCIALFLGFVLTLGMTLLRHVWGYMYS
NEPEVVAYIAKMLPVLGISFFIDGLHGSLSGVLTGCGKQKIGATVNLGAFYLAGIPMAVL
LAFVFHLNGMGLWLGIVCGSLIKVLLFASVTWTIDWSMEATKAKDRVFGSSLPVA
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggaccacaagcaagacacggagccgctgctcccggcggcggacgaatggtgccggcag
ggcctcgccgcggccgaggcgaagcggctggttcgcctcgccgggccgatgatcaccagc
tgcttgctgcagaacatcatcaacataatgtccctcatgttcgtcggccacctcggcgag
cttcccctcgccggcgcctccctcgccaactccgtcgccagcgtcaccggcttcagtatc
atcatcggcatggcgactgcgctggacacgctgtgcgggcaggcgtacggcgcgcggcag
caccacctgctcggcgtctacaagcagcgcgccatggtggtgctcgggctcacctgcgtc
cccatcgccgtcgtctgggcgcacaccggccggatcctggtgctcctcggccaggacccg
cgcatcgccgccgaggccggcgcctacgcgcggtggctcatcccgtcgcttgccgtgagc
gtgccgctgcagtgccacgtccggttcctgcaggcgcagagcctcgtcctgcccgtgacg
gccagctcggccgccgcggcactctgccacctcgccgtgtgctgggcgctcgtgttcaag
gccggcatgggtgccaaaggagccgcgctcagcaacgccatctcgtacgccgtgaacctg
gtgatgctgtccctgtacgtcaggctgtcgagctcctgcagggacacgtggaacgggttc
tccatggaggggtttaaggatctgcgcaaattcgccgatctcgccgtgccctctgcgatg
atgatctgcttggagtggtgggctttcgaaacacttgtgctgctgtctggtcttctgccc
aaccctcagctggagacttcagtgctgtcaatttgccttaacactgggattcttctcttc
atgataccatcggggcttggttattctgtgagcacgcgcgtttccaacgaacttggtgct
ggacagcctcaggcagcaaagttggcaacgagggtagtcgtgtgcatcgccttgttccta
ggcttcgtcctgaccttgggcatgaccctgctacgccacgtttgggggtacatgtacagc
aacgagccggaggtcgtggcatacattgccaagatgctgccggttcttgggatatctttc
ttcatagatggccttcacggatctctctcaggcgtgctcacgggctgcggcaagcaaaag
atcggcgccacggtgaacctcggcgcgttctacttggcaggcatccctatggcggtgctg
cttgcgtttgtcttccatctcaatggaatgggcctttggctcggcatcgtctgcggcagc
ctcatcaaagtgctcttgtttgcatctgtcacatggaccatagactggagcatggaagct
accaaggcaaaggacagggtattcggctcatctctgccagtagcatga

DBGET integrated database retrieval system