Turicibacter sp. KK003: VXM77_04510 Help Entry VXM77_04510       CDS       T10570                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism tuk  Turicibacter sp. KK003 Brite KEGG Orthology (KO) [BR:tuk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:tuk03032]     VXM77_04510    03036 Chromosome and associated proteins [BR:tuk03036]     VXM77_04510    03400 DNA repair and recombination proteins [BR:tuk03400]     VXM77_04510 DNA replication proteins [BR:tuk03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     VXM77_04510 Chromosome and associated proteins [BR:tuk03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     VXM77_04510 DNA repair and recombination proteins [BR:tuk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       VXM77_04510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Transposase_mut RNA_polI_A14 DUF3933 Motif Other DBs NCBI-ProteinID:  WWR14113 LinkDB All DBs Position 883626..883898 Genome browser AA seq 90 aa AA seqDB search MNRSQLVDKIAEKAELTKKEADKFLSAYIETVTEALQEDDKVALVGFGTFEVRERAARQG RNLHTGETIEIEASKYPAFKAGKALKDALK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaatcgttctcaattagtagataaaatcgctgaaaaggcggagttaacaaagaaagaa gcagataaatttttaagtgcgtacattgaaacagtaactgaagcattacaagaggatgat aaagttgctttagtagggtttggaacttttgaggttcgtgaacgtgctgctcgtcaagga cgcaatttacatactggagaaacaattgaaattgaagcgagtaaatacccagcatttaaa gcaggtaaagctttaaaagatgctttaaaataa

DBGET integrated database retrieval system