Tumebacillus avium: CBW65_14940
Help
Entry
CBW65_14940 CDS
T04874
Name
(GenBank) AAC(3) family N-acetyltransferase
KO
K00662
aminoglycoside 3-N-acetyltransferase [EC:
2.3.1.81
]
Organism
tum
Tumebacillus avium
Brite
KEGG Orthology (KO) [BR:
tum00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
01504 Antimicrobial resistance genes [BR:
tum01504
]
CBW65_14940
Enzymes [BR:
tum01000
]
2. Transferases
2.3 Acyltransferases
2.3.1 Transferring groups other than aminoacyl groups
2.3.1.81 aminoglycoside 3-N-acetyltransferase
CBW65_14940
Antimicrobial resistance genes [BR:
tum01504
]
Gene variants
Aminoglycoside resistance genes
N-Acetyltransferases
CBW65_14940
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Antibiotic_NAT
Motif
Other DBs
NCBI-ProteinID:
ARU62152
UniProt:
A0A1Y0INJ8
LinkDB
All DBs
Position
3117882..3118691
Genome browser
AA seq
269 aa
AA seq
DB search
MSEQKTIASAPMPRTRQSLADDLRALGLREGMTVIVHSSLSSLGWVCGGAVAVVQALMDV
LTEKGTLVMPTHSSEFSDPKYWQNPPVPKEWHEIIRETMPAFDPQITPTRGMGKIVDTFR
TFPGVLRSYHPHVSFAAWGKHKELVTANHSLAYGLGDGSPLARIYELDGSVLLLGVGYDC
NTSLHLSEHRAPGTVLEKLGSPIFKDGQRIWATFEDIEIDSSQFPEVGEQFEAAHPTQAG
KIGSADAKLIGQRALVDFGTAYFAKKRGF
NT seq
810 nt
NT seq
+upstream
nt +downstream
nt
atgagcgaacaaaagacaatcgcatcagcacccatgccgcgcacacgccaaagtctggcg
gacgacttgcgggcgctggggctgcgggaagggatgacggtgatcgtccactcgtcgttg
tcgtcgctgggctgggtctgcggaggtgcagtggcggtggtgcaggcgctgatggatgtt
ttgactgaaaaaggtacgctggtgatgccgacgcactcgtcggagttctctgacccgaag
tattggcagaatccgccggtgccgaaggaatggcatgagatcattcgtgagacgatgcct
gcctttgacccgcagattacgccgacgcgcgggatggggaagatcgtggataccttccgc
acgtttccgggcgtactgcgctcgtatcatccgcatgtatcgtttgcggcgtggggcaag
cataaggaactggtgactgccaaccactcgctcgcctatgggctcggcgatgggtcgccg
ctggcacgcatctatgagttggacggctcggtgctgctgctcggcgtcgggtatgactgc
aacacttcgctgcacctgtcggaacaccgcgcgccgggcaccgtactggaaaagctcggc
tcgccgatcttcaaggacggccagcgcatctgggcgacgtttgaagacattgagatcgac
tcttcgcagtttccggaagtcggtgagcagttcgaagctgcccacccgactcaggcagga
aaaatcggctcagctgatgcaaaactgatcgggcagcgggctctggtcgatttcgggacg
gcgtattttgcgaaaaagcggggcttctaa
DBGET
integrated database retrieval system