Tumebacillus avium: CBW65_20070 Help Entry CBW65_20070       CDS       T04874                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism tum  Tumebacillus avium Brite KEGG Orthology (KO) [BR:tum00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:tum03032]     CBW65_20070    03036 Chromosome and associated proteins [BR:tum03036]     CBW65_20070    03400 DNA repair and recombination proteins [BR:tum03400]     CBW65_20070 DNA replication proteins [BR:tum03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CBW65_20070 Chromosome and associated proteins [BR:tum03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CBW65_20070 DNA repair and recombination proteins [BR:tum03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CBW65_20070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 DUF2267 HU-CCDC81_euk_1 Rpf1_C Glycos_trans_3N Motif Other DBs NCBI-ProteinID:  ARU63013 UniProt:  A0A1Y0IUF6 LinkDB All DBs Position complement(4347946..4348218) Genome browser AA seq 90 aa AA seqDB search MNKTDLVNLVAEKADLSKKDAASAVDAVFDGIVEALATGDKVQLIGFGNFEVRERSARKG RNPQTGEEIDIAAAKVPAFKPGKQFKDSIK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagacggatctggtcaacctcgtagccgaaaaggcggacctctccaagaaggat gctgcgagcgcagtagacgcagtattcgacggtattgtagaagcactggcaactggtgat aaggtgcaactgatcggcttcggtaacttcgaagtccgtgagcgttccgctcgcaaaggt cgcaacccgcaaaccggtgaagagatcgatatcgctgctgcaaaggttccggcattcaaa ccgggcaagcaattcaaagattccatcaagtaa

DBGET integrated database retrieval system