Tumebacillus avium: CBW65_20325
Help
Entry
CBW65_20325 CDS
T04874
Name
(GenBank) pyridoxal-5'-phosphate-dependent protein subunit beta
KO
K01733
threonine synthase [EC:
4.2.3.1
]
Organism
tum
Tumebacillus avium
Pathway
tum00260
Glycine, serine and threonine metabolism
tum00750
Vitamin B6 metabolism
tum01100
Metabolic pathways
tum01110
Biosynthesis of secondary metabolites
tum01120
Microbial metabolism in diverse environments
tum01230
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:
tum00001
]
09100 Metabolism
09105 Amino acid metabolism
00260 Glycine, serine and threonine metabolism
CBW65_20325
09108 Metabolism of cofactors and vitamins
00750 Vitamin B6 metabolism
CBW65_20325
Enzymes [BR:
tum01000
]
4. Lyases
4.2 Carbon-oxygen lyases
4.2.3 Acting on phosphates
4.2.3.1 threonine synthase
CBW65_20325
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
PALP
HypA
Motif
Other DBs
NCBI-ProteinID:
ARU63059
UniProt:
A0A1Y0IST1
LinkDB
All DBs
Position
complement(4418243..4419436)
Genome browser
AA seq
397 aa
AA seq
DB search
MYIQNEAATKLSCLRCGAEYELNDYTTGCPACLEGGYPVSLEVKYSVTPGWTVNAKLRGM
KRFADKLPYRTFPTLGEGDTPLIDLPDLAEELGLQGLWLKNEGQNPTGSHKDRMSAQVVA
RAKATGRTTVVAASSGNAGASLAAYAAAAGLRCVIVTTVGMNPTWDQAVRATGAELVAAY
DSKLRWKYMRKMVESEGWYPVTNYIDPPTGSNLWGVQGYKTCGHEIAEAFAGNAPTAIVV
PTSRGDLLWGIWRGLQEAKEAGWIDTLPRLYAAEPFGRLSRVLAGDDYRGHFPGDHSSTE
SIGGSTATFQSLVALRESGGGAVDVAGVDAVDGQNKLARRGLYLESSSAVVWAAVKQLKA
TGQIGEQDRVVLIGTSNGYKDNYFSKLPEMKIIDAAD
NT seq
1194 nt
NT seq
+upstream
nt +downstream
nt
atgtacatacaaaatgaagcagcgacgaaattgtcctgcctgcgctgcggggcggagtat
gagctgaatgattacacgaccggctgcccggcttgtttggaaggagggtatccggtctcc
ttagaagtgaagtatagcgtgacgccgggctggacggtcaatgcgaaactgcgcggcatg
aagcgatttgcagacaaactgccgtaccgcacgttcccgacgctcggcgaaggagacacg
ccgctgatcgacctgccggacttggcggaagagttgggactgcaagggctgtggctgaaa
aatgaagggcagaacccgaccggctcgcacaaagaccggatgagcgcacaggtggtcgcc
cgcgccaaagcgacggggcgcacgacggtggtggccgcatcgagcggcaacgccggagca
tcgctggcggcgtatgcggctgcggccgggctgcgctgcgtgatcgtgacaacggtcggc
atgaacccgacgtgggatcaggcggtgcgagctaccggggcggaactggtcgcagcctac
gactcgaaactgcgctggaaatacatgcgcaagatggtggaaagcgaaggctggtacccg
gtgacgaactacatcgatccgccgacgggcagcaatctgtggggcgtgcaagggtataag
acctgcgggcatgagatcgcggaggcatttgcaggaaatgcgccgacggcgatcgtggtg
ccgacgtcgcgcggcgacttgctgtgggggatctggcgtggcttgcaggaggcgaaagaa
gcaggctggatcgacactttgccgcgcttgtatgcggctgagccgtttgggcggctgtcg
cgggtgctggcaggcgatgactatcgagggcacttcccgggcgaccacagcagcaccgag
tcgatcggcgggtccacagcgacgttccagtcgctggtcgccctgcgcgaatcgggcggc
ggcgcggtagatgtcgccggtgttgatgctgtggacgggcaaaacaagctggcgcggcgc
gggctgtatctggaaagctcctccgccgtggtctgggcggccgtcaagcagttaaaagcg
accgggcagatcggcgaacaggaccgcgtcgtgctgatcgggacgtcgaacggctacaaa
gacaactatttttccaagctgccggaaatgaagatcatcgacgcggcagactag
DBGET
integrated database retrieval system