Tupaia chinensis (Chinese tree shrew): 102467714 Help Entry 102467714         CDS       T02978                                  Symbol UCN Name (RefSeq) urocortin   KO K23142   urocortin Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04080   Neuroactive ligand-receptor interaction tup04081   Hormone signaling Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102467714 (UCN)    04081 Hormone signaling     102467714 (UCN)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102467714 (UCN) Cytokines and neuropeptides [BR:tup04052]  Neuropeptides   GPCR binding    102467714 (UCN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CRF Motif Other DBs NCBI-GeneID:  102467714 NCBI-ProteinID:  XP_006162283 LinkDB All DBs Position Un AA seq 110 aa AA seqDB search HLRPGSSQWSPAAAVAASAQDPSLRWSPGTRNQGGGARALLLLLAERFPRRAGPGRWESG TAGERPRRDDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRVIFDSVGK NT seq 333 nt NT seq  +upstreamnt  +downstreamnt catctgcgccccgggagcagccagtggagcccggcagcagcggtggcggccagcgcccag gaccccagtctacggtggagtcccgggacgcggaaccagggaggcggcgcccgagcgctc ctcttgctgctggcagagcgcttcccacgtcgggcggggcccggccgatgggaatccggg acagcaggcgagcggccacgacgggacgaccctccattgtccattgacctcaccttccac ctgctgcggacgctgctggagctggcgcggacgcagagccagcgggagcgagccgagcag aatcgcgtcatattcgactctgtgggcaagtga

DBGET integrated database retrieval system