Tupaia chinensis (Chinese tree shrew): 102468234 Help Entry 102468234         CDS       T02978                                  Symbol MRAS Name (RefSeq) muscle RAS oncogene homolog   KO K07831   Ras-related protein M-Ras Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04010   MAPK signaling pathway tup04014   Ras signaling pathway tup04015   Rap1 signaling pathway tup04072   Phospholipase D signaling pathway tup04137   Mitophagy - animal tup04140   Autophagy - animal tup04218   Cellular senescence tup04371   Apelin signaling pathway tup04625   C-type lectin receptor signaling pathway tup04810   Regulation of actin cytoskeleton tup05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102468234 (MRAS)    04014 Ras signaling pathway     102468234 (MRAS)    04015 Rap1 signaling pathway     102468234 (MRAS)    04371 Apelin signaling pathway     102468234 (MRAS)    04072 Phospholipase D signaling pathway     102468234 (MRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102468234 (MRAS)    04137 Mitophagy - animal     102468234 (MRAS)   09143 Cell growth and death    04218 Cellular senescence     102468234 (MRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102468234 (MRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102468234 (MRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102468234 (MRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:tup04031]     102468234 (MRAS) GTP-binding proteins [BR:tup04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102468234 (MRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 AAA_16 MMR_HSR1_Xtn Motif Other DBs NCBI-GeneID:  102468234 NCBI-ProteinID:  XP_006158245 LinkDB All DBs Position Un AA seq 208 aa AA seqDB search MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQW AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFP MILVANKVDLMHLRKITREQGKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIP EKSQKKKKKTKWRGDRASGTHKLQCVIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggcaaccagcgccgtccccagcgacaacctccccacgtacaagctggtggtggtgggg gacgggggtgtgggcaagagtgccctcaccatccagtttttccagaagatctttgtgcct gactacgaccccaccatcgaagattcctacctgaaacacacagagattgacaatcaatgg gccatcttggacgttctggacacggccgggcaggaggagttcagcgccatgcgggagcag tacatgcgcaccggggacggcttcctcatcgtcttctccgtcaccgacaaggccagcttc gagcacgtggaccggttccaccagctcatcctgcgcgtcaaggacagagagtcgttcccg atgatcctcgtggccaacaaggtcgatttgatgcacttgaggaaaatcaccagggagcaa ggaaaagaaatggcgacgaaacacaatattccgtacatagagaccagtgccaaggaccca cctctcaacgttgacaaagccttccatgacctcgttcgggtcatcaggcaacagattcca gagaaaagccagaagaagaagaaaaagaccaagtggcggggagaccgggccagtggtacc cacaaactgcagtgtgtgatcttgtga

DBGET integrated database retrieval system