Tupaia chinensis (Chinese tree shrew): 102468910 Help Entry 102468910         CDS       T02978                                  Symbol CCL7 Name (RefSeq) C-C motif chemokine 7   KO K05509   C-C motif chemokine 7 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04060   Cytokine-cytokine receptor interaction tup04061   Viral protein interaction with cytokine and cytokine receptor tup04062   Chemokine signaling pathway tup04657   IL-17 signaling pathway Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102468910 (CCL7)    04061 Viral protein interaction with cytokine and cytokine receptor     102468910 (CCL7)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     102468910 (CCL7)    04062 Chemokine signaling pathway     102468910 (CCL7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102468910 (CCL7) Cytokines and neuropeptides [BR:tup04052]  Cytokines   Chemokines    102468910 (CCL7) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  102468910 NCBI-ProteinID:  XP_006154446 UniProt:  L9KGU8 LinkDB All DBs Position Un AA seq 98 aa AA seqDB search MKVSAVLLCLLLSAATFSLQGLAQPNGLSTSTCCYKFTNKMIPKQRLESYRRITSSYCPQ EAVIFKTKLARNVCADPQQKWVQDSIAYLDKKAQNPKP NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctctgcagtgcttctgtgcctgctgctctcagcagccaccttcagcctccaa gggcttgcccagccaaatgggcttagtacctcaacctgctgctataaattcactaacaag atgatccctaagcagagactggaaagttacagaagaatcaccagcagctattgtccccag gaagctgtgatcttcaagaccaaactggccaggaatgtctgtgctgacccccagcagaag tgggtccaagactccattgcctacctggacaagaaagcccaaaatccaaagccttga

DBGET integrated database retrieval system