Tupaia chinensis (Chinese tree shrew): 102469016 Help Entry 102469016         CDS       T02978                                  Symbol CCL28 Name (RefSeq) C-C motif chemokine ligand 28   KO K05513   C-C motif chemokine 28 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04060   Cytokine-cytokine receptor interaction tup04061   Viral protein interaction with cytokine and cytokine receptor tup04062   Chemokine signaling pathway tup04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102469016 (CCL28)    04061 Viral protein interaction with cytokine and cytokine receptor     102469016 (CCL28)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     102469016 (CCL28)    04062 Chemokine signaling pathway     102469016 (CCL28)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102469016 (CCL28) Cytokines and neuropeptides [BR:tup04052]  Cytokines   Chemokines    102469016 (CCL28) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Neur_chan_memb Motif Other DBs NCBI-GeneID:  102469016 NCBI-ProteinID:  XP_006172223 LinkDB All DBs Position Un AA seq 87 aa AA seqDB search RLLXRVNICRIQQADGDCNLAAIILHIKHRRVCVSPHNHTMKQWMKEQVAKKNGKGNMCH KKKQHSQRKKKGAHRGKHRTFDHQVPY NT seq 264 nt NT seq  +upstreamnt  +downstreamnt aggcttctgtaaagagtgaatatatgccgcatccagcaagctgatggggattgcaatttg gctgctatcatccttcacatcaagcacaggagagtctgtgtcagcccgcacaaccacact atgaaacagtggatgaaagaacaagtggctaagaaaaacggcaaaggcaacatgtgccac aagaagaaacagcacagccagaggaagaagaaaggagcacaccgcgggaagcataggaca tttgaccatcaagttccctattag

DBGET integrated database retrieval system