Tupaia chinensis (Chinese tree shrew): 102469574 Help Entry 102469574         CDS       T02978                                  Name (RefSeq) interferon omega-1   KO K05414   interferon alpha Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04060   Cytokine-cytokine receptor interaction tup04151   PI3K-Akt signaling pathway tup04217   Necroptosis tup04620   Toll-like receptor signaling pathway tup04621   NOD-like receptor signaling pathway tup04622   RIG-I-like receptor signaling pathway tup04623   Cytosolic DNA-sensing pathway tup04630   JAK-STAT signaling pathway tup04650   Natural killer cell mediated cytotoxicity tup04936   Alcoholic liver disease tup05152   Tuberculosis tup05160   Hepatitis C tup05161   Hepatitis B tup05162   Measles tup05163   Human cytomegalovirus infection tup05164   Influenza A tup05165   Human papillomavirus infection tup05167   Kaposi sarcoma-associated herpesvirus infection tup05168   Herpes simplex virus 1 infection tup05169   Epstein-Barr virus infection tup05170   Human immunodeficiency virus 1 infection tup05171   Coronavirus disease - COVID-19 tup05200   Pathways in cancer tup05320   Autoimmune thyroid disease tup05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102469574    04151 PI3K-Akt signaling pathway     102469574   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102469574  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102469574  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102469574    04621 NOD-like receptor signaling pathway     102469574    04622 RIG-I-like receptor signaling pathway     102469574    04623 Cytosolic DNA-sensing pathway     102469574    04650 Natural killer cell mediated cytotoxicity     102469574  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102469574   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102469574    05161 Hepatitis B     102469574    05160 Hepatitis C     102469574    05171 Coronavirus disease - COVID-19     102469574    05164 Influenza A     102469574    05162 Measles     102469574    05168 Herpes simplex virus 1 infection     102469574    05163 Human cytomegalovirus infection     102469574    05167 Kaposi sarcoma-associated herpesvirus infection     102469574    05169 Epstein-Barr virus infection     102469574    05165 Human papillomavirus infection     102469574   09171 Infectious disease: bacterial    05152 Tuberculosis     102469574   09163 Immune disease    05320 Autoimmune thyroid disease     102469574   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102469574   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102469574  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102469574 Cytokines and neuropeptides [BR:tup04052]  Cytokines   Interferons    102469574 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon ToxS Motif Other DBs NCBI-GeneID:  102469574 NCBI-ProteinID:  XP_006167085 LinkDB All DBs Position Un AA seq 208 aa AA seqDB search MVKVLNFQRSDHGSSPVPGCEEVAGSQCPRALSRPSVVRLHLLMVMLCLNPAYSLGWSMP SSLQGESRETLRKLRQLQNVPSGSCIHDRINFRFPWKPHQFHETEATCFYHQMLDQIFNL FHTEDSHAPWGDLLLSQLLASLHYQQTELAKVQNLTCPDLGNVVRNYFRRIASYLQKKKY SPCAWERVRREIEERLFLLVSEAASEES NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggttaaggtgctgaacttccaacggagcgatcatggttcgagtcctgtacctggatgc gaagaagtcgctgggtcccagtgcccgcgcgccctctcgcggccatcagtggtccgtctc cacctgctaatggtgatgctctgcctcaacccagcctactccctgggctggagcatgcct tccagtcttcaaggggaaagcagggaaaccttgaggaagttgagacaactacaaaacgtt ccttctgggtcgtgcatccatgacagaatcaacttccgatttccttggaaaccacaccaa ttccacgagacagaagccacctgtttctaccaccagatgttggaccagatcttcaacctc ttccacacagaggacagccatgctccgtggggtgacctcctcctctctcagctactggcc agccttcattaccaacagacggagttggcgaaagtccaaaatctgacttgtcccgacttg ggaaatgttgtccggaactatttccgaagaatcgcctcctacctacagaaaaagaaatac agcccctgtgcctgggagcgtgtcaggagggaaattgaagagcgcctgttcctcctggtc agcgaggcagcaagtgaagaaagttag

DBGET integrated database retrieval system