Tupaia chinensis (Chinese tree shrew): 102470309 Help Entry 102470309         CDS       T02978                                  Symbol CSNK2B Name (RefSeq) casein kinase 2 beta   KO K03115   casein kinase II subunit beta Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup03008   Ribosome biogenesis in eukaryotes tup03083   Polycomb repressive complex tup04064   NF-kappa B signaling pathway tup04137   Mitophagy - animal tup04310   Wnt signaling pathway tup04520   Adherens junction tup05010   Alzheimer disease tup05020   Prion disease tup05022   Pathways of neurodegeneration - multiple diseases tup05162   Measles tup05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:tup00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     102470309 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     102470309 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     102470309 (CSNK2B)    04064 NF-kappa B signaling pathway     102470309 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     102470309 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     102470309 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102470309 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     102470309 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     102470309 (CSNK2B)    05020 Prion disease     102470309 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     102470309 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:tup03009]     102470309 (CSNK2B)    03036 Chromosome and associated proteins [BR:tup03036]     102470309 (CSNK2B) Ribosome biogenesis [BR:tup03009]  Eukaryotic type   90S particles    Kinase     102470309 (CSNK2B) Chromosome and associated proteins [BR:tup03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      102470309 (CSNK2B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  102470309 NCBI-ProteinID:  XP_006154337 UniProt:  L9KH77 LinkDB All DBs Position Un AA seq 235 aa AA seqDB search MEKCKGTSGKMAGAASADVKMSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLN EQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEK YQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFG TGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 708 nt NT seq  +upstreamnt  +downstreamnt atggagaagtgcaaggggacgagcggcaaaatggcaggcgccgcctcagctgacgtgaag atgagcagctcagaggaggtgtcctggatttcttggttctgcgggctccggggcaatgaa ttcttctgtgaagtggatgaagactacatccaggacaaatttaatcttactggactcaat gagcaggtgcctcactatcgacaagctctagacatgatcttggacctggagcctgatgaa gagctggaagacaaccccaaccagagtgacctgattgagcaggcagctgagatgctttat ggattgatccacgcccgctacatcctcaccaaccgtggcatcgcccagatgttggaaaag taccagcagggagactttggctactgtccccgtgtgtattgcgagaaccagccaatgctt cccatcggcctctcggacatcccaggcgaggccatggtgaagctctactgtcccaagtgc atggatgtgtatacacccaaatcgtcgaggcaccatcacacagatggcgcctacttcggc actggtttccctcacatgctcttcatggtgcatcccgaatatcggcccaagcgacctgcc aaccagtttgtgcccaggctctacggtttcaagatccacccgatggcctaccagctgcaa ctccaagctgccagcaacttcaagagcccagtcaagacaattcgctga

DBGET integrated database retrieval system