Tupaia chinensis (Chinese tree shrew): 102470384 Help Entry 102470384         CDS       T02978                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04613   Neutrophil extracellular trap formation tup05034   Alcoholism tup05202   Transcriptional misregulation in cancer tup05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:tup00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102470384  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102470384   09163 Immune disease    05322 Systemic lupus erythematosus     102470384   09165 Substance dependence    05034 Alcoholism     102470384  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tup03036]     102470384   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tup04147]     102470384 Chromosome and associated proteins [BR:tup03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102470384 Exosome [BR:tup04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102470384 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF Motif Other DBs NCBI-GeneID:  102470384 NCBI-ProteinID:  XP_006163187 UniProt:  L8YAG7 LinkDB All DBs Position Un AA seq 136 aa AA seqDB search MARTKQTAHKSTGGKAPRKQLVTKAARKSAPSTGGVKKPHRYRSSTVALREIRRCRKSTE LLIRKLPFQLLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKCVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagacagcccacaaatccaccggtggtaaagcacccaggaagcaa ctggttacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggtccagtactgtggcactccgtgaaattagacgttgtcggaagtccactgaa cttctgattcgcaaacttcctttccagcttctggtgcgagaaattgctcaggatttcaaa acagatctgcgcttccagagcgcagctattggtgctttgcaggaggcaagtgaggcctac ttggttggccttttcgaagataccaacctgtgtgctatccatgccaaatgtgtaacaatc atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system