Tupaia chinensis (Chinese tree shrew): 102470639 Help Entry 102470639         CDS       T02978                                  Symbol PSMA7 Name (RefSeq) proteasome subunit alpha 7   KO K02731   20S proteasome subunit alpha 4 [EC:3.4.25.1] Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup03050   Proteasome tup05010   Alzheimer disease tup05012   Parkinson disease tup05014   Amyotrophic lateral sclerosis tup05016   Huntington disease tup05017   Spinocerebellar ataxia tup05020   Prion disease tup05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:tup00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     102470639 (PSMA7)  09160 Human Diseases   09164 Neurodegenerative disease    05010 Alzheimer disease     102470639 (PSMA7)    05012 Parkinson disease     102470639 (PSMA7)    05014 Amyotrophic lateral sclerosis     102470639 (PSMA7)    05016 Huntington disease     102470639 (PSMA7)    05017 Spinocerebellar ataxia     102470639 (PSMA7)    05020 Prion disease     102470639 (PSMA7)    05022 Pathways of neurodegeneration - multiple diseases     102470639 (PSMA7)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:tup01002]     102470639 (PSMA7)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tup04131]     102470639 (PSMA7)    03051 Proteasome [BR:tup03051]     102470639 (PSMA7) Enzymes [BR:tup01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.25  Threonine endopeptidases     3.4.25.1  proteasome endopeptidase complex      102470639 (PSMA7) Peptidases and inhibitors [BR:tup01002]  Threonine peptidases   Family T1: proteasome family    102470639 (PSMA7) Membrane trafficking [BR:tup04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab associated proteins     102470639 (PSMA7) Proteasome [BR:tup03051]  Eukaryotic proteasome   Core particles (20S proteasome)    alpha type subunits     102470639 (PSMA7) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Proteasome RecA_C Motif Other DBs NCBI-GeneID:  102470639 NCBI-ProteinID:  XP_006157789 UniProt:  L9JIG6 LinkDB All DBs Position Un AA seq 178 aa AA seqDB search MAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYVASLKQRYTQSNGRRPFGIS ALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTEDAMDSADLTIKL VIKALLEVVQSGGKNIELAVMRRDQPLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atggcctttgcaggccttacagccgacgccaggattgtcatcaaccgggcgcgggtcgag tgccagagccaccggctgacggtggaagacccagtcactgtggagtacatcacacgctat gtggccagcctcaagcagcggtacacgcagagcaacgggcgtaggccattcggcatctct gccctgattgtgggcttcgacttcgacggcacccccaggctatatcagactgacccctcg gggacataccacgcctggaaggccaacgccataggccggggcgccaagtcagtgcgtgaa ttcctggagaaaaactacaccgaggacgccatggactccgctgacctgaccattaagctg gtgatcaaggctctcctagaagtggtgcagtcaggaggcaaaaacatcgagctggccgtg atgagacgagaccagcctctcaagattttaaatccggaagaaattgagaaatatgttgct gaaatcgaaaaagaaaaagaagaaaacgaaaagaagaagcaaaagaaagcgtcgtga

DBGET integrated database retrieval system