Tupaia chinensis (Chinese tree shrew): 102471830 Help Entry 102471830         CDS       T02978                                  Symbol MYL6 Name (RefSeq) myosin light chain 6   KO K12751   myosin light chain 6 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04270   Vascular smooth muscle contraction tup04530   Tight junction tup04814   Motor proteins tup04921   Oxytocin signaling pathway Brite KEGG Orthology (KO) [BR:tup00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102471830 (MYL6)   09142 Cell motility    04814 Motor proteins     102471830 (MYL6)  09150 Organismal Systems   09152 Endocrine system    04921 Oxytocin signaling pathway     102471830 (MYL6)   09153 Circulatory system    04270 Vascular smooth muscle contraction     102471830 (MYL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:tup04812]     102471830 (MYL6)    04147 Exosome [BR:tup04147]     102471830 (MYL6) Cytoskeleton proteins [BR:tup04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      102471830 (MYL6) Exosome [BR:tup04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102471830 (MYL6)   Exosomal proteins of bladder cancer cells    102471830 (MYL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF_EFCAB10_C AIF-1 EF-hand_9 EF-hand_5 Motif Other DBs NCBI-GeneID:  102471830 NCBI-ProteinID:  XP_006165661 LinkDB All DBs Position Un AA seq 151 aa AA seqDB search MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEM NVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKM TEEEVEMLVAGHEDSNGCINYEAFVRHILSG NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgtgtgacttcaccgaagaccagaccgcagagttcaaggaggccttccagctgtttgac cggacaggggatggcaagatcctgtacagccagtgtggggatgtgatgagggccctgggc cagaaccccaccaacgccgaggtgctcaaggtcctggggaaccccaagagtgacgagatg aatgtgaaggtgctggacttcgagcacttcctgcctatgctgcagacggtggccaagaat aaggaccagggcacttatgaggactacgttgaaggccttcgggtgtttgacaaggaaggg aacggcaccgtcatgggtgctgaaattcggcacgtcctcgtcacattgggggagaagatg acagaggaagaagtggagatgctggtggcagggcacgaggacagcaatggttgtatcaac tatgaagcgtttgtgaggcatatcctgtcggggtga

DBGET integrated database retrieval system