Tupaia chinensis (Chinese tree shrew): 102472375 Help Entry 102472375         CDS       T02978                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04613   Neutrophil extracellular trap formation tup05034   Alcoholism tup05202   Transcriptional misregulation in cancer tup05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:tup00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102472375  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102472375   09163 Immune disease    05322 Systemic lupus erythematosus     102472375   09165 Substance dependence    05034 Alcoholism     102472375  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tup03036]     102472375   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tup04147]     102472375 Chromosome and associated proteins [BR:tup03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102472375 Exosome [BR:tup04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102472375 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  102472375 NCBI-ProteinID:  XP_006147050 LinkDB All DBs Position Un AA seq 140 aa AA seqDB search MVLAMARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQ KSTELLIRKLPFQRLVREIAQDFKTDLRFQTSAVMALQEACESYLVGLFEDTNLCAIHAK RVTIMPKDIQLARRIRGERA NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggtgttagcgatggcccgcaccaagcagacggcgcgcaagtctaccggcggcaaggca ccgcgcaaacagctggctacgaaggtggctcgcaagagcgcaccagccactggcggggtg aagaagcctcatcgctacaggccaggcactgtggcactgcgcgagatccgccgctaccag aagtctactgagctgttgatccgcaagctgccattccagcggctggtgcgtgagatcgcg caggatttcaagacagacctgcgtttccagacctcagcagtgatggcgctccaggaggcg tgtgagtcctacctcgtgggactcttcgaggataccaacctgtgtgccatccacgctaag cgtgtcaccatcatgcccaaggatatccagctggcacgccgaatccgcggagagcgagcc tag

DBGET integrated database retrieval system