Tupaia chinensis (Chinese tree shrew): 102473176 Help Entry 102473176         CDS       T02978                                  Symbol MYL10 Name (RefSeq) myosin light chain 10   KO K12756   myosin regulatory light chain 10 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04510   Focal adhesion tup04520   Adherens junction tup04670   Leukocyte transendothelial migration tup04810   Regulation of actin cytoskeleton tup04814   Motor proteins tup05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tup00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     102473176 (MYL10)    04520 Adherens junction     102473176 (MYL10)   09142 Cell motility    04814 Motor proteins     102473176 (MYL10)    04810 Regulation of actin cytoskeleton     102473176 (MYL10)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102473176 (MYL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102473176 (MYL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:tup04812]     102473176 (MYL10) Cytoskeleton proteins [BR:tup04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      102473176 (MYL10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 EF_EFCAB10_C AIF-1 Motif Other DBs NCBI-GeneID:  102473176 NCBI-ProteinID:  XP_006155728 LinkDB All DBs Position Un AA seq 147 aa AA seqDB search MFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINF TVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFIKADFIKEKLMTQADRFSEEEVKQMF AAFPPDVCGNLDYRNLCYVITHGEEKD NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgtttgatcagtcccagatccaggagtttaaagaggccttcaccatcatggaccagaac cgggatggcttcattgacaaggaagacctgagggacacctttgctgcactgggtcgcatc aatgtgaagaacgaagagctggaggccatggtgaaggaggctccagggcccatcaacttc acggtcttcctgaccatgtttggagagaagctgaagggcacagacccggaggagaccatt ctccatgccttcaaggtgttcgacaccgaggggaaaggtttcatcaaggctgatttcatc aaagagaagctcatgacccaggcagaccggttcagtgaggaggaggtcaagcagatgttt gctgctttcccgccagatgtgtgtggcaacctggactataggaacctgtgttacgtcatc acacatggcgaggagaaggactag

DBGET integrated database retrieval system