Tupaia chinensis (Chinese tree shrew): 102474175 Help Entry 102474175         CDS       T02978                                  Symbol FGF21 Name (RefSeq) fibroblast growth factor 21   KO K22429   fibroblast growth factor 21 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04010   MAPK signaling pathway tup04014   Ras signaling pathway tup04015   Rap1 signaling pathway tup04020   Calcium signaling pathway tup04151   PI3K-Akt signaling pathway tup04714   Thermogenesis tup04810   Regulation of actin cytoskeleton tup05200   Pathways in cancer tup05218   Melanoma tup05224   Breast cancer tup05226   Gastric cancer Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102474175 (FGF21)    04014 Ras signaling pathway     102474175 (FGF21)    04015 Rap1 signaling pathway     102474175 (FGF21)    04020 Calcium signaling pathway     102474175 (FGF21)    04151 PI3K-Akt signaling pathway     102474175 (FGF21)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102474175 (FGF21)  09150 Organismal Systems   09159 Environmental adaptation    04714 Thermogenesis     102474175 (FGF21)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102474175 (FGF21)   09162 Cancer: specific types    05226 Gastric cancer     102474175 (FGF21)    05218 Melanoma     102474175 (FGF21)    05224 Breast cancer     102474175 (FGF21)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102474175 (FGF21)    00536 Glycosaminoglycan binding proteins [BR:tup00536]     102474175 (FGF21) Cytokines and neuropeptides [BR:tup04052]  Cytokines   Growth factors (RTK binding)    102474175 (FGF21) Glycosaminoglycan binding proteins [BR:tup00536]  Heparan sulfate / Heparin   Growth factors/receptors    102474175 (FGF21) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  102474175 NCBI-ProteinID:  XP_006160247 UniProt:  L9JA54 LinkDB All DBs Position Un AA seq 209 aa AA seqDB search MGWDKARFEHLGAWAPVLAVLLLGACQAYPIPDSSPLLQFGGQVRQRYLYTDDTQDTEAH LEIRADGTVVGAAHQSPESLLELKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA CSFRELLLEDGYNIYQSEARGLPLRLPPHDSPHRDRTPQGPARFLPLPGLPLVPPELPGV LALEPPDVGSSDPLSMMGPSQGQSPSYAS NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atgggctgggacaaggcccggttcgagcacctgggagcgtgggctcctgtgctggctgtc ctcctcctgggagcctgccaggcataccccatccctgactccagccccctcctacaattc gggggccaggtccggcagcggtacctctacacggacgacacgcaggacacagaagcccac cttgagatcagggccgacggcaccgtggtgggggccgcccaccaaagcccggaaagtctc ctggagctgaaagccttgaagccgggggtcattcaaatcctgggagtcaagacctccagg ttcctgtgccagaggccagacggggccctgtacggctcgcttcacttcgaccccgaggcc tgcagcttccgggagctgcttctcgaggatggatacaacatttaccagtctgaggctcgt ggcctccccctgcgcctgccgccccatgactccccacatcgggaccggacccctcaggga ccagctcgtttcctgccgctgcctggcctgcccctggttcctccagagctgccaggggtc ctggcccttgagccccccgacgtgggctcctcagacccgctgagcatgatggggccctcg cagggccaaagccccagctacgcttcctga

DBGET integrated database retrieval system