Tupaia chinensis (Chinese tree shrew): 102475482 Help Entry 102475482         CDS       T02978                                  Name (RefSeq) interferon omega-1   KO K05414   interferon alpha Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04060   Cytokine-cytokine receptor interaction tup04151   PI3K-Akt signaling pathway tup04217   Necroptosis tup04620   Toll-like receptor signaling pathway tup04621   NOD-like receptor signaling pathway tup04622   RIG-I-like receptor signaling pathway tup04623   Cytosolic DNA-sensing pathway tup04630   JAK-STAT signaling pathway tup04650   Natural killer cell mediated cytotoxicity tup04936   Alcoholic liver disease tup05152   Tuberculosis tup05160   Hepatitis C tup05161   Hepatitis B tup05162   Measles tup05163   Human cytomegalovirus infection tup05164   Influenza A tup05165   Human papillomavirus infection tup05167   Kaposi sarcoma-associated herpesvirus infection tup05168   Herpes simplex virus 1 infection tup05169   Epstein-Barr virus infection tup05170   Human immunodeficiency virus 1 infection tup05171   Coronavirus disease - COVID-19 tup05200   Pathways in cancer tup05320   Autoimmune thyroid disease tup05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102475482    04151 PI3K-Akt signaling pathway     102475482   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102475482  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102475482  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102475482    04621 NOD-like receptor signaling pathway     102475482    04622 RIG-I-like receptor signaling pathway     102475482    04623 Cytosolic DNA-sensing pathway     102475482    04650 Natural killer cell mediated cytotoxicity     102475482  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102475482   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102475482    05161 Hepatitis B     102475482    05160 Hepatitis C     102475482    05171 Coronavirus disease - COVID-19     102475482    05164 Influenza A     102475482    05162 Measles     102475482    05168 Herpes simplex virus 1 infection     102475482    05163 Human cytomegalovirus infection     102475482    05167 Kaposi sarcoma-associated herpesvirus infection     102475482    05169 Epstein-Barr virus infection     102475482    05165 Human papillomavirus infection     102475482   09171 Infectious disease: bacterial    05152 Tuberculosis     102475482   09163 Immune disease    05320 Autoimmune thyroid disease     102475482   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102475482   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102475482  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102475482 Cytokines and neuropeptides [BR:tup04052]  Cytokines   Interferons    102475482 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  102475482 NCBI-ProteinID:  XP_006164238 UniProt:  L8Y906 LinkDB All DBs Position Un AA seq 187 aa AA seqDB search MALSVSSLMVMVMVFSGPIGSLSCDLPQSLDSGKQETLTALAQMGTISFLSCLKDRTDFK FPQEQLDGRQLQKTQALRVLHGMLQQIFNLFSSEGSSATWEEALLDKLLAGLHQQLEDLE TCLVQGVGEEPSALETDSTTLALRGYFQGLHLYLEKKNFSDCAWEVVRVEIRKCFLFINK LIRKLRN NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggccttgtcagtctcctctctgatggtgatggtgatggtgttctctggccccatcggc tccctcagctgtgacctgcctcagagccttgactcgggaaagcaggagaccttgacagct ctggcccaaatggggaccatctcctttctctcctgtctgaaggataggactgacttcaaa ttcccccaggagcagctggacggcagacagctccagaaaactcaggccctccgtgtcctc cacgggatgctgcagcagatcttcaacctgttcagctcagagggctcctctgccacctgg gaggaggccctcctggacaaactcctcgctggacttcatcaacagctggaagacctggag acctgcttagtgcagggggtgggagaggagccgtctgccctggaaactgacagcacaacg ctggctctgagggggtacttccagggcctccatctctacctggaaaagaagaacttcagt gactgtgcctgggaggtggtcagagtggaaatcaggaagtgcttcctcttcattaacaag ctcatcagaaaactcaggaattaa

DBGET integrated database retrieval system