Tupaia chinensis (Chinese tree shrew): 102476690 Help Entry 102476690         CDS       T02978                                  Symbol BAK1 Name (RefSeq) BCL2 antagonist/killer 1   KO K14021   Bcl-2 homologous antagonist/killer Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup01524   Platinum drug resistance tup04141   Protein processing in endoplasmic reticulum tup04210   Apoptosis tup04215   Apoptosis - multiple species tup05022   Pathways of neurodegeneration - multiple diseases tup05132   Salmonella infection tup05160   Hepatitis C tup05162   Measles tup05163   Human cytomegalovirus infection tup05164   Influenza A tup05165   Human papillomavirus infection tup05167   Kaposi sarcoma-associated herpesvirus infection tup05168   Herpes simplex virus 1 infection tup05169   Epstein-Barr virus infection tup05170   Human immunodeficiency virus 1 infection tup05200   Pathways in cancer tup05202   Transcriptional misregulation in cancer tup05203   Viral carcinogenesis tup05206   MicroRNAs in cancer tup05210   Colorectal cancer tup05212   Pancreatic cancer tup05213   Endometrial cancer tup05214   Glioma tup05216   Thyroid cancer tup05217   Basal cell carcinoma tup05218   Melanoma tup05220   Chronic myeloid leukemia tup05222   Small cell lung cancer tup05223   Non-small cell lung cancer tup05224   Breast cancer tup05225   Hepatocellular carcinoma tup05226   Gastric cancer Brite KEGG Orthology (KO) [BR:tup00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102476690 (BAK1)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102476690 (BAK1)    04215 Apoptosis - multiple species     102476690 (BAK1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102476690 (BAK1)    05202 Transcriptional misregulation in cancer     102476690 (BAK1)    05206 MicroRNAs in cancer     102476690 (BAK1)    05203 Viral carcinogenesis     102476690 (BAK1)   09162 Cancer: specific types    05210 Colorectal cancer     102476690 (BAK1)    05212 Pancreatic cancer     102476690 (BAK1)    05225 Hepatocellular carcinoma     102476690 (BAK1)    05226 Gastric cancer     102476690 (BAK1)    05214 Glioma     102476690 (BAK1)    05216 Thyroid cancer     102476690 (BAK1)    05220 Chronic myeloid leukemia     102476690 (BAK1)    05217 Basal cell carcinoma     102476690 (BAK1)    05218 Melanoma     102476690 (BAK1)    05213 Endometrial cancer     102476690 (BAK1)    05224 Breast cancer     102476690 (BAK1)    05222 Small cell lung cancer     102476690 (BAK1)    05223 Non-small cell lung cancer     102476690 (BAK1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102476690 (BAK1)    05160 Hepatitis C     102476690 (BAK1)    05164 Influenza A     102476690 (BAK1)    05162 Measles     102476690 (BAK1)    05168 Herpes simplex virus 1 infection     102476690 (BAK1)    05163 Human cytomegalovirus infection     102476690 (BAK1)    05167 Kaposi sarcoma-associated herpesvirus infection     102476690 (BAK1)    05169 Epstein-Barr virus infection     102476690 (BAK1)    05165 Human papillomavirus infection     102476690 (BAK1)   09171 Infectious disease: bacterial    05132 Salmonella infection     102476690 (BAK1)   09164 Neurodegenerative disease    05022 Pathways of neurodegeneration - multiple diseases     102476690 (BAK1)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102476690 (BAK1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:tup03029]     102476690 (BAK1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:tup02000]     102476690 (BAK1) Mitochondrial biogenesis [BR:tup03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     102476690 (BAK1) Transporters [BR:tup02000]  Other transporters   Pores ion channels [TC:1]    102476690 (BAK1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 Bcl-2_3 Motif Other DBs NCBI-GeneID:  102476690 NCBI-ProteinID:  XP_006144279 LinkDB All DBs Position Un AA seq 211 aa AA seqDB search MASGQGPGPPRQECGEPAPTSASEEQVARDTEEVFRSYVFYRHRQEQESEEVAAPADPEM DSLPLEPNSTMGQVGRQLAIIGDDINRRYDSEFQAMLQQLQPTAENAYEYFTKIASSLFE SGINWGRVVALLGFGYRLALHVYQRGLRGFLGQVARFVADFMLRHCIARWIAQRGGWVAA LDLGNGPIRNVLMVLGVVLLGQFVVRRFFKS NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggcatccgggcagggcccagggcctcccaggcaggagtgtggagagcctgccccgacc tccgcttctgaggagcaggtagcccgggacacagaggaggttttccgcagctacgttttt taccgccatcggcaggagcaggagtctgaggaggtggccgcccccgccgacccagagatg gactccttgcccctagaaccaaatagcaccatggggcaggtgggccggcagctcgccatc atcggggacgacatcaaccgacgctatgactcggagttccaggccatgctgcagcaactg cagcccacagcggagaacgcctacgagtacttcaccaagatcgcctccagcctgtttgag agcggcatcaactggggccgagtggtggcgctcctgggcttcggataccgcctggccctc cacgtctaccagcgcggcctgaggggcttcctgggccaagtggcccgcttcgtggccgac ttcatgctgcgccactgcatcgcccggtggatcgcgcagagaggcggctgggtggcagcc ctggacctgggcaacggccccatcaggaatgtgctgatggttctgggtgtggttctgttg ggtcagtttgtggtacgaagattcttcaagtcatga

DBGET integrated database retrieval system