Tupaia chinensis (Chinese tree shrew): 102476928 Help Entry 102476928         CDS       T02978                                  Symbol GNG7 Name (RefSeq) G protein subunit gamma 7   KO K04543   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04014   Ras signaling pathway tup04062   Chemokine signaling pathway tup04081   Hormone signaling tup04082   Neuroactive ligand signaling tup04151   PI3K-Akt signaling pathway tup04371   Apelin signaling pathway tup04713   Circadian entrainment tup04723   Retrograde endocannabinoid signaling tup04724   Glutamatergic synapse tup04725   Cholinergic synapse tup04726   Serotonergic synapse tup04727   GABAergic synapse tup04728   Dopaminergic synapse tup04740   Olfactory transduction tup04926   Relaxin signaling pathway tup05032   Morphine addiction tup05034   Alcoholism tup05163   Human cytomegalovirus infection tup05167   Kaposi sarcoma-associated herpesvirus infection tup05170   Human immunodeficiency virus 1 infection tup05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102476928 (GNG7)    04371 Apelin signaling pathway     102476928 (GNG7)    04151 PI3K-Akt signaling pathway     102476928 (GNG7)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     102476928 (GNG7)    04081 Hormone signaling     102476928 (GNG7)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     102476928 (GNG7)   09152 Endocrine system    04926 Relaxin signaling pathway     102476928 (GNG7)   09156 Nervous system    04724 Glutamatergic synapse     102476928 (GNG7)    04727 GABAergic synapse     102476928 (GNG7)    04725 Cholinergic synapse     102476928 (GNG7)    04728 Dopaminergic synapse     102476928 (GNG7)    04726 Serotonergic synapse     102476928 (GNG7)    04723 Retrograde endocannabinoid signaling     102476928 (GNG7)   09157 Sensory system    04740 Olfactory transduction     102476928 (GNG7)   09159 Environmental adaptation    04713 Circadian entrainment     102476928 (GNG7)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102476928 (GNG7)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102476928 (GNG7)    05163 Human cytomegalovirus infection     102476928 (GNG7)    05167 Kaposi sarcoma-associated herpesvirus infection     102476928 (GNG7)   09165 Substance dependence    05032 Morphine addiction     102476928 (GNG7)    05034 Alcoholism     102476928 (GNG7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tup04147]     102476928 (GNG7)    04031 GTP-binding proteins [BR:tup04031]     102476928 (GNG7) Exosome [BR:tup04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102476928 (GNG7)   Exosomal proteins of other body fluids (saliva and urine)    102476928 (GNG7) GTP-binding proteins [BR:tup04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     102476928 (GNG7) BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  102476928 NCBI-ProteinID:  XP_014441038 LinkDB All DBs Position Un AA seq 116 aa AA seqDB search MSEPGDGALAMGLCRPGKAAARPPPSPWQTMSVTNNIAQARKLVEQLRLEAGVDRIKGHL RHPAPGEGVKELGPFMPRSGTQRWKGRPGPCGSVGDSQERVREERLTQQDSAVPAA NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgagcgagccaggtgatggcgccctggcgatgggactgtgccgcccaggaaaggccgca gctcggccgccacccagcccatggcagacgatgtctgtcactaacaacatcgcacaggcc cggaagctggtggagcagctccgactggaggccggagtggaccgcatcaagggacatctc aggcatccagcccccggtgaaggcgtgaaggagctgggcccattcatgccccggagtggc actcagcgctggaaggggcggcctggcccgtgcggcagcgtgggtgactcacaggagcgt gtgcgagaggagcgtcttacacaacaggacagtgcggtgccagctgcgtga

DBGET integrated database retrieval system