Tupaia chinensis (Chinese tree shrew): 102477656 Help Entry 102477656         CDS       T02978                                  Symbol SEC61B Name (RefSeq) Sec61 translocon beta subunit   KO K09481   protein transport protein SEC61 subunit beta Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup03060   Protein export tup04141   Protein processing in endoplasmic reticulum tup04145   Phagosome Brite KEGG Orthology (KO) [BR:tup00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     102477656 (SEC61B)    04141 Protein processing in endoplasmic reticulum     102477656 (SEC61B)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102477656 (SEC61B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tup04131]     102477656 (SEC61B)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tup02044]     102477656 (SEC61B) Membrane trafficking [BR:tup04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     102477656 (SEC61B) Secretion system [BR:tup02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    102477656 (SEC61B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  102477656 NCBI-ProteinID:  XP_006161443 LinkDB All DBs Position Un AA seq 96 aa AA seqDB search MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYT EDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgcctggtccgacccccagtggcactaacgtgggctcttcagggcgctctcccagcaag gcagtggccgcccgggccgcgggatccactgtccggcagaggaaaaatgccagctgtgga acaagaagtgcaggccgcacaacctcagcaggtactggggggatgtggcgattctacaca gaagactcaccagggctcaaagttggccctgttccagtactggttatgagtcttctgttc atcgcttctgtatttatgttgcacatttggggcaagtacactcgctcatag

DBGET integrated database retrieval system