Tupaia chinensis (Chinese tree shrew): 102479053 Help Entry 102479053         CDS       T02978                                  Symbol PPIF Name (RefSeq) peptidylprolyl isomerase F   KO K09565   peptidyl-prolyl isomerase F (cyclophilin D) [EC:5.2.1.8] Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04020   Calcium signaling pathway tup04022   cGMP-PKG signaling pathway tup04613   Neutrophil extracellular trap formation tup05010   Alzheimer disease tup05012   Parkinson disease tup05016   Huntington disease tup05017   Spinocerebellar ataxia tup05020   Prion disease tup05022   Pathways of neurodegeneration - multiple diseases tup05145   Toxoplasmosis tup05208   Chemical carcinogenesis - reactive oxygen species tup05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04020 Calcium signaling pathway     102479053 (PPIF)    04022 cGMP-PKG signaling pathway     102479053 (PPIF)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102479053 (PPIF)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     102479053 (PPIF)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102479053 (PPIF)   09164 Neurodegenerative disease    05010 Alzheimer disease     102479053 (PPIF)    05012 Parkinson disease     102479053 (PPIF)    05016 Huntington disease     102479053 (PPIF)    05017 Spinocerebellar ataxia     102479053 (PPIF)    05020 Prion disease     102479053 (PPIF)    05022 Pathways of neurodegeneration - multiple diseases     102479053 (PPIF)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     102479053 (PPIF)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:tup03110]     102479053 (PPIF) Enzymes [BR:tup01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      102479053 (PPIF) Chaperones and folding catalysts [BR:tup03110]  Protein folding catalysts   Peptidyl prolyl isomerase    Cyclophilin     102479053 (PPIF) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pro_isomerase Motif Other DBs NCBI-GeneID:  102479053 NCBI-ProteinID:  XP_006154961 UniProt:  L9KFG6 LinkDB All DBs Position Un AA seq 206 aa AA seqDB search MLALRCGSRVLGLLSVPRSAPQRLSAVRASSGGGSRDPSSSSRNPLVYLDVDADGQPLGR VVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIY GSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVV KKIESFGSKSGKPSKKIVITDCGQLS NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atgctggcgctgcgctgtggctctcgcgtccttggcctgctctctgtcccgcgctctgcg ccgcagcgtctctccgcggtgcgtgcctccagcggcggcggctcccgcgacccatcctct tcctcccggaacccgctagtgtacctggacgtggacgccgacgggcagccgctcggccgc gtggtgctagagctgaaggcagatgtcgtcccaaagacagccgagaacttcagagccctg tgcactggtgagaagggcttcggctacaaaggttcgaccttccacagggtgatcccatcc ttcatgtgccaggcaggtgacttcaccaaccacaacggcactggggggaaatccatctac ggaagccgctttcctgatgagaacttcacgctgaagcacgtgggaccaggtgtcttgtcc atggcaaacgcaggccccaataccaatggctcccagttcttcatctgcaccatcaagaca gactggctggatggcaagcatgttgtgtttggccatgtcaaagagggcatggatgtcgtg aaaaaaattgaatcttttggctctaaaagtggaaagccatccaagaagattgtcatcaca gattgtggccaactgagctaa

DBGET integrated database retrieval system