Tupaia chinensis (Chinese tree shrew): 102479323 Help Entry 102479323         CDS       T02978                                  Symbol GNAI1 Name (RefSeq) G protein subunit alpha i1   KO K04630   guanine nucleotide-binding protein G(i) subunit alpha Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04015   Rap1 signaling pathway tup04022   cGMP-PKG signaling pathway tup04024   cAMP signaling pathway tup04062   Chemokine signaling pathway tup04071   Sphingolipid signaling pathway tup04081   Hormone signaling tup04082   Neuroactive ligand signaling tup04261   Adrenergic signaling in cardiomyocytes tup04360   Axon guidance tup04371   Apelin signaling pathway tup04540   Gap junction tup04611   Platelet activation tup04670   Leukocyte transendothelial migration tup04713   Circadian entrainment tup04723   Retrograde endocannabinoid signaling tup04724   Glutamatergic synapse tup04725   Cholinergic synapse tup04726   Serotonergic synapse tup04727   GABAergic synapse tup04728   Dopaminergic synapse tup04730   Long-term depression tup04914   Progesterone-mediated oocyte maturation tup04915   Estrogen signaling pathway tup04916   Melanogenesis tup04921   Oxytocin signaling pathway tup04923   Regulation of lipolysis in adipocytes tup04924   Renin secretion tup04926   Relaxin signaling pathway tup04928   Parathyroid hormone synthesis, secretion and action tup04934   Cushing syndrome tup04935   Growth hormone synthesis, secretion and action tup04971   Gastric acid secretion tup05012   Parkinson disease tup05030   Cocaine addiction tup05032   Morphine addiction tup05034   Alcoholism tup05133   Pertussis tup05142   Chagas disease tup05145   Toxoplasmosis tup05163   Human cytomegalovirus infection tup05170   Human immunodeficiency virus 1 infection tup05200   Pathways in cancer tup05207   Chemical carcinogenesis - receptor activation Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102479323 (GNAI1)    04371 Apelin signaling pathway     102479323 (GNAI1)    04071 Sphingolipid signaling pathway     102479323 (GNAI1)    04024 cAMP signaling pathway     102479323 (GNAI1)    04022 cGMP-PKG signaling pathway     102479323 (GNAI1)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     102479323 (GNAI1)    04081 Hormone signaling     102479323 (GNAI1)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04540 Gap junction     102479323 (GNAI1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102479323 (GNAI1)    04670 Leukocyte transendothelial migration     102479323 (GNAI1)    04062 Chemokine signaling pathway     102479323 (GNAI1)   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     102479323 (GNAI1)    04915 Estrogen signaling pathway     102479323 (GNAI1)    04914 Progesterone-mediated oocyte maturation     102479323 (GNAI1)    04921 Oxytocin signaling pathway     102479323 (GNAI1)    04926 Relaxin signaling pathway     102479323 (GNAI1)    04935 Growth hormone synthesis, secretion and action     102479323 (GNAI1)    04928 Parathyroid hormone synthesis, secretion and action     102479323 (GNAI1)    04916 Melanogenesis     102479323 (GNAI1)    04924 Renin secretion     102479323 (GNAI1)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102479323 (GNAI1)   09154 Digestive system    04971 Gastric acid secretion     102479323 (GNAI1)   09156 Nervous system    04724 Glutamatergic synapse     102479323 (GNAI1)    04727 GABAergic synapse     102479323 (GNAI1)    04725 Cholinergic synapse     102479323 (GNAI1)    04728 Dopaminergic synapse     102479323 (GNAI1)    04726 Serotonergic synapse     102479323 (GNAI1)    04730 Long-term depression     102479323 (GNAI1)    04723 Retrograde endocannabinoid signaling     102479323 (GNAI1)   09158 Development and regeneration    04360 Axon guidance     102479323 (GNAI1)   09159 Environmental adaptation    04713 Circadian entrainment     102479323 (GNAI1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102479323 (GNAI1)    05207 Chemical carcinogenesis - receptor activation     102479323 (GNAI1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102479323 (GNAI1)    05163 Human cytomegalovirus infection     102479323 (GNAI1)   09171 Infectious disease: bacterial    05133 Pertussis     102479323 (GNAI1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102479323 (GNAI1)    05142 Chagas disease     102479323 (GNAI1)   09164 Neurodegenerative disease    05012 Parkinson disease     102479323 (GNAI1)   09165 Substance dependence    05030 Cocaine addiction     102479323 (GNAI1)    05032 Morphine addiction     102479323 (GNAI1)    05034 Alcoholism     102479323 (GNAI1)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     102479323 (GNAI1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tup04147]     102479323 (GNAI1)    04031 GTP-binding proteins [BR:tup04031]     102479323 (GNAI1) Exosome [BR:tup04147]  Exosomal proteins   Proteins found in most exosomes    102479323 (GNAI1) GTP-binding proteins [BR:tup04031]  Heterotrimeric G-proteins   Alpha Subunits    Alpha type 1 (Gi/o) [OT]     102479323 (GNAI1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-alpha Arf Gtr1_RagA TniB FtsK_SpoIIIE AAA_29 Motif Other DBs NCBI-GeneID:  102479323 NCBI-ProteinID:  XP_006154410 LinkDB All DBs Position Un AA seq 354 aa AA seqDB search MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQSNYIPTQQDVLRTRVK TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt atgggctgcacgctgagcgccgaggacaaggcagcggtggagcggagtaagatgatcgac cgcaacctccgcgaggatggcgagaaggcggcccgcgaggtcaagctgctgctgctcggt gctggtgaatctgggaaaagtacaattgtgaagcagatgaaaattatccatgaagctggt tactcagaagaggagtgtaagcagtacaaagcagtcgtctacagtaataccatccagtcc attattgccatcatcagggccatggggaggttgaagatagacttcggtgactcagctcgg gcggatgatgcccgccaactctttgtgcttgctggagctgctgaagaaggctttatgact gctgaacttgctggagttataaagagattgtggaaagatagtggtgtacaagcctgtttc aacagatcccgagagtaccagcttaatgattctgcagcatactacttgaatgacttggac agaatagcacagtcaaattatatcccaactcaacaagatgttcttagaacgagagtgaaa actacaggaattgttgaaacccattttactttcaaagatcttcattttaaaatgtttgac gtgggaggtcagagatccgagcgaaagaagtggatccattgctttgaaggagtgactgcc atcatcttctgtgtggcactgagtgactatgacctggttctagccgaagacgaagaaatg aatcgaatgcatgaaagcatgaagttgttcgacagcatatgtaacaacaaatggtttaca gatacatctatcatactttttctaaacaagaaggatctctttgaagaaaaaatcaaaaag agccctctcactatatgctatccagaatatgcaggatcaaacacatacgaagaggcagct gcatatattcaatgtcagtttgaagatctcaataaaagaaaggacacaaaggaaatatac acccacttcacatgtgccacagatactaagaatgtgcagtttgtttttgatgccgtaaca gatgtcatcataaaaaataatctaaaagattgtggtctcttctga

DBGET integrated database retrieval system