Tupaia chinensis (Chinese tree shrew): 102479773 Help Entry 102479773         CDS       T02978                                  Symbol CALML5 Name (RefSeq) calmodulin like 5   KO K02183   calmodulin Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04014   Ras signaling pathway tup04015   Rap1 signaling pathway tup04020   Calcium signaling pathway tup04022   cGMP-PKG signaling pathway tup04024   cAMP signaling pathway tup04070   Phosphatidylinositol signaling system tup04114   Oocyte meiosis tup04218   Cellular senescence tup04261   Adrenergic signaling in cardiomyocytes tup04270   Vascular smooth muscle contraction tup04371   Apelin signaling pathway tup04625   C-type lectin receptor signaling pathway tup04713   Circadian entrainment tup04720   Long-term potentiation tup04722   Neurotrophin signaling pathway tup04728   Dopaminergic synapse tup04740   Olfactory transduction tup04744   Phototransduction tup04750   Inflammatory mediator regulation of TRP channels tup04910   Insulin signaling pathway tup04912   GnRH signaling pathway tup04915   Estrogen signaling pathway tup04916   Melanogenesis tup04921   Oxytocin signaling pathway tup04922   Glucagon signaling pathway tup04924   Renin secretion tup04925   Aldosterone synthesis and secretion tup04970   Salivary secretion tup04971   Gastric acid secretion tup05010   Alzheimer disease tup05012   Parkinson disease tup05022   Pathways of neurodegeneration - multiple diseases tup05031   Amphetamine addiction tup05034   Alcoholism tup05133   Pertussis tup05152   Tuberculosis tup05163   Human cytomegalovirus infection tup05167   Kaposi sarcoma-associated herpesvirus infection tup05170   Human immunodeficiency virus 1 infection tup05200   Pathways in cancer tup05214   Glioma tup05417   Lipid and atherosclerosis tup05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102479773 (CALML5)    04015 Rap1 signaling pathway     102479773 (CALML5)    04371 Apelin signaling pathway     102479773 (CALML5)    04020 Calcium signaling pathway     102479773 (CALML5)    04070 Phosphatidylinositol signaling system     102479773 (CALML5)    04024 cAMP signaling pathway     102479773 (CALML5)    04022 cGMP-PKG signaling pathway     102479773 (CALML5)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102479773 (CALML5)    04218 Cellular senescence     102479773 (CALML5)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102479773 (CALML5)   09152 Endocrine system    04910 Insulin signaling pathway     102479773 (CALML5)    04922 Glucagon signaling pathway     102479773 (CALML5)    04912 GnRH signaling pathway     102479773 (CALML5)    04915 Estrogen signaling pathway     102479773 (CALML5)    04921 Oxytocin signaling pathway     102479773 (CALML5)    04916 Melanogenesis     102479773 (CALML5)    04924 Renin secretion     102479773 (CALML5)    04925 Aldosterone synthesis and secretion     102479773 (CALML5)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102479773 (CALML5)    04270 Vascular smooth muscle contraction     102479773 (CALML5)   09154 Digestive system    04970 Salivary secretion     102479773 (CALML5)    04971 Gastric acid secretion     102479773 (CALML5)   09156 Nervous system    04728 Dopaminergic synapse     102479773 (CALML5)    04720 Long-term potentiation     102479773 (CALML5)    04722 Neurotrophin signaling pathway     102479773 (CALML5)   09157 Sensory system    04744 Phototransduction     102479773 (CALML5)    04740 Olfactory transduction     102479773 (CALML5)    04750 Inflammatory mediator regulation of TRP channels     102479773 (CALML5)   09159 Environmental adaptation    04713 Circadian entrainment     102479773 (CALML5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102479773 (CALML5)   09162 Cancer: specific types    05214 Glioma     102479773 (CALML5)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102479773 (CALML5)    05163 Human cytomegalovirus infection     102479773 (CALML5)    05167 Kaposi sarcoma-associated herpesvirus infection     102479773 (CALML5)   09171 Infectious disease: bacterial    05133 Pertussis     102479773 (CALML5)    05152 Tuberculosis     102479773 (CALML5)   09164 Neurodegenerative disease    05010 Alzheimer disease     102479773 (CALML5)    05012 Parkinson disease     102479773 (CALML5)    05022 Pathways of neurodegeneration - multiple diseases     102479773 (CALML5)   09165 Substance dependence    05031 Amphetamine addiction     102479773 (CALML5)    05034 Alcoholism     102479773 (CALML5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102479773 (CALML5)    05418 Fluid shear stress and atherosclerosis     102479773 (CALML5)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:tup01009]     102479773 (CALML5)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tup04131]     102479773 (CALML5)    03036 Chromosome and associated proteins [BR:tup03036]     102479773 (CALML5)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tup04147]     102479773 (CALML5) Protein phosphatases and associated proteins [BR:tup01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102479773 (CALML5) Membrane trafficking [BR:tup04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     102479773 (CALML5) Chromosome and associated proteins [BR:tup03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      102479773 (CALML5) Exosome [BR:tup04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102479773 (CALML5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 AIF-1 EF-hand_9 EF-hand_FSTL1 SPARC_Ca_bdg Dockerin_1 EH DUF5580_M EF-hand_EFHB_C TerB SAPC2_N EF-hand_11 UPF0154 SurA_N_3 ThsA_Macro FCaBP_EF-hand EF-hand_STIM1 EFhand_Ca_insen RTX_C SurA_N_2 ERAP1_C PBP-Tp47_c Phytochelatin EcoRI_methylase Motif Other DBs NCBI-GeneID:  102479773 NCBI-ProteinID:  XP_006158531 UniProt:  L9JCM5 LinkDB All DBs Position Un AA seq 148 aa AA seqDB search MAENLPSEVVAEYKEAFDRVDTNGDGKINVQELGAMMKAVGKNASEEELKMLIASVDTDG DGAISFEEFLQAMAKMNNKDNKEGMLMAFQAFDQNGDGHITMEELKLVMSKLGEQLTQEE LDTMIREADLNQDGKVDYEEFVRILSEK NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggctgagaatctgccttcagaggtagtggctgagtataaggaggcctttgatagagtt gacaccaatggggatggcaagatcaacgtccaggagctgggtgctatgatgaaggccgtg gggaagaatgcatctgaggaagagctaaagatgctcattgcctcagtggacacagatggt gatggagccatcagctttgaagagttcttacaggcaatggccaagatgaataacaaagac aacaaggagggcatgctgatggccttccaggcctttgaccagaacggtgacggccacatc accatggaggagctcaagctggtcatgtccaaactgggggaacagcttactcaggaggag ctggacaccatgatccgtgaggccgacttgaaccaagacgggaaggtggactacgaggag tttgtgcgcatactctccgaaaagtga

DBGET integrated database retrieval system