Tupaia chinensis (Chinese tree shrew): 102479950 Help Entry 102479950         CDS       T02978                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04613   Neutrophil extracellular trap formation tup05034   Alcoholism tup05202   Transcriptional misregulation in cancer tup05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:tup00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102479950  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102479950   09163 Immune disease    05322 Systemic lupus erythematosus     102479950   09165 Substance dependence    05034 Alcoholism     102479950  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tup03036]     102479950   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tup04147]     102479950 Chromosome and associated proteins [BR:tup03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102479950 Exosome [BR:tup04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102479950 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  102479950 NCBI-ProteinID:  XP_014448833 UniProt:  L8Y720 LinkDB All DBs Position Un AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgcacgaagcagacggctcgcaagtccaccggcggcaaggccccgcgcaaacag ctggccaccaaggcggcccgcaagagcgccccggccacgggcggcgtgaagaagccgcac cgctaccggcccggcaccgtggcgctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgtgcgaggcctac ctggtggggctgttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgcggggagagggcataa

DBGET integrated database retrieval system