Tupaia chinensis (Chinese tree shrew): 102481282 Help Entry 102481282         CDS       T02978                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine ligand 5   KO K12499   C-C motif chemokine 5 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04060   Cytokine-cytokine receptor interaction tup04061   Viral protein interaction with cytokine and cytokine receptor tup04062   Chemokine signaling pathway tup04620   Toll-like receptor signaling pathway tup04621   NOD-like receptor signaling pathway tup04623   Cytosolic DNA-sensing pathway tup04668   TNF signaling pathway tup05020   Prion disease tup05142   Chagas disease tup05163   Human cytomegalovirus infection tup05164   Influenza A tup05168   Herpes simplex virus 1 infection tup05323   Rheumatoid arthritis tup05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     102481282 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102481282 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     102481282 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102481282 (CCL5)    04621 NOD-like receptor signaling pathway     102481282 (CCL5)    04623 Cytosolic DNA-sensing pathway     102481282 (CCL5)    04062 Chemokine signaling pathway     102481282 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     102481282 (CCL5)    05168 Herpes simplex virus 1 infection     102481282 (CCL5)    05163 Human cytomegalovirus infection     102481282 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     102481282 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     102481282 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     102481282 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102481282 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102481282 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:tup00536]     102481282 (CCL5) Cytokines and neuropeptides [BR:tup04052]  Cytokines   Chemokines    102481282 (CCL5) Glycosaminoglycan binding proteins [BR:tup00536]  Heparan sulfate / Heparin   Chemokines    102481282 (CCL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  102481282 NCBI-ProteinID:  XP_006154474 LinkDB All DBs Position Un AA seq 91 aa AA seqDB search MKTSAVVLVVILTAAALCSPASASPYASDTTPCCFAYISRPLPRTHLREYFYTSGKCSNP AVVFITRKNRQVCANPEKKWVREYINSLEMS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaagacctctgcggttgtcctcgttgtcatcctcactgctgctgccctctgcagtcct gcatctgcctccccatatgcctcggacaccacgccctgctgcttcgcctacatctcccgc ccactgccccgtacccacctcagagagtatttctacaccagtggcaagtgctccaaccca gcagttgtgtttatcacccgaaagaaccgccaggtgtgtgccaacccggagaagaaatgg gttcgggaatacatcaactctttggagatgagctag

DBGET integrated database retrieval system