Tupaia chinensis (Chinese tree shrew): 102481748 Help Entry 102481748         CDS       T02978                                  Symbol ATG12 Name (RefSeq) autophagy related 12   KO K08336   ubiquitin-like protein ATG12 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04068   FoxO signaling pathway tup04136   Autophagy - other tup04140   Autophagy - animal tup04621   NOD-like receptor signaling pathway tup04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     102481748 (ATG12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102481748 (ATG12)    04136 Autophagy - other     102481748 (ATG12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102481748 (ATG12)    04622 RIG-I-like receptor signaling pathway     102481748 (ATG12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tup04131]     102481748 (ATG12)    04121 Ubiquitin system [BR:tup04121]     102481748 (ATG12)    03029 Mitochondrial biogenesis [BR:tup03029]     102481748 (ATG12) Membrane trafficking [BR:tup04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     102481748 (ATG12) Ubiquitin system [BR:tup04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    102481748 (ATG12) Mitochondrial biogenesis [BR:tup03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     102481748 (ATG12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  102481748 NCBI-ProteinID:  XP_006158447 LinkDB All DBs Position Un AA seq 140 aa AA seqDB search MAEEPESVLQLPPSAAAGGEGLTEVSPETVTPEPPSSAAVSPGTEEPAGDTKKKIDILLK AVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLY ECFGSDGKLVLHYCKSQAWG NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcggaggagccggagtccgtgctgcagctccctccgtccgctgctgctggcggcgaa ggacttacggaggtctccccagaaacagtcactccggagcccccttcttccgctgcggtc tctccggggacagaggaacctgctggtgacaccaagaaaaaaattgacatcctcctaaag gctgtaggagatacccctattatgaaaacaaagaagtgggctgttgagcggacccgaacc atccaaggacttattgacttcatcaaaaagttccttaaacttgtcgcctcagagcagttg tttatttacgtaaatcagtccttcgctccttccccggaccaggaagttgggaccctgtat gagtgttttggcagtgatggtaaactggtcctacattactgcaagtctcaggcatgggga tga

DBGET integrated database retrieval system