Tupaia chinensis (Chinese tree shrew): 102482106 Help Entry 102482106         CDS       T02978                                  Symbol S100A10 Name (RefSeq) S100 calcium binding protein A10   KO K17274   protein S100-A10 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04382   Cornified envelope formation tup05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tup00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     102482106 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102482106 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tup04147]     102482106 (S100A10) Exosome [BR:tup04147]  Exosomal proteins   Exosomal proteins of microglial cells    102482106 (S100A10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  102482106 NCBI-ProteinID:  XP_006168457 UniProt:  L8Y8N6 LinkDB All DBs Position Un AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGFLTKEDLRLLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLIIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggagcacgccatggaaaccatgatgtttacctttcacaaatttgct ggggacaaaggcttcttgacaaaggaggacctgagattactcatggaaaaggagttccca ggatttttggaaaatcaaaaagaccctctggctgtggacaaaataatgaaggacctggac cagtgccgagatggcaaagtgggcttccagagctttttttcactaattgcaggcctgatc attgcatgcaacgactattttgtagtacacatgaagcagaagggaaagaagtag

DBGET integrated database retrieval system