Tupaia chinensis (Chinese tree shrew): 102482336 Help Entry 102482336         CDS       T02978                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04613   Neutrophil extracellular trap formation tup05034   Alcoholism tup05203   Viral carcinogenesis tup05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:tup00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102482336  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102482336   09163 Immune disease    05322 Systemic lupus erythematosus     102482336   09165 Substance dependence    05034 Alcoholism     102482336  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tup03036]     102482336 Chromosome and associated proteins [BR:tup03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102482336 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  102482336 NCBI-ProteinID:  XP_006162724 UniProt:  L8YAP0 LinkDB All DBs Position Un AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaagggcgggaagggcctgggcaagggcggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagccggccatccgccgcctggcccgg cgcggcggcgtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacaccgagcacgccaagcgcaag acggtcacggccatggacgtggtgtacgcgctcaagcgccagggccgcaccctctacggc ttcggcggctga

DBGET integrated database retrieval system