KEGG   Tupaia chinensis (Chinese tree shrew): 102483211
Entry
102483211         CDS       T02978                                 
Symbol
ITGAX
Name
(RefSeq) integrin subunit alpha X
  KO
K06462  integrin alpha X
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04610  Complement and coagulation cascades
tup04810  Regulation of actin cytoskeleton
tup05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102483211 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    102483211 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102483211 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:tup04515]
    102483211 (ITGAX)
   04090 CD molecules [BR:tup04090]
    102483211 (ITGAX)
Cell adhesion molecules [BR:tup04515]
 Integrins
  Integrin alpha subunits
   102483211 (ITGAX)
CD molecules [BR:tup04090]
 Proteins
  102483211 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 Integrin_alpha FG-GAP_3
Other DBs
NCBI-GeneID: 102483211
NCBI-ProteinID: XP_006148170
LinkDB
Position
Un
AA seq 1249 aa
MSDLPIMTGTRTALLLLMASAASLCFNLDTEQPTTFQVDSAGFGHSVVQYANTGLVVGAP
REIQAANQTGGLYQCDYRTSRCQPIHLQVPPEAVNMSLGLSLAASTNPSQLLACGPTVHH
ACRENVHLTGLCFLLTSSFRWTQRFPAALQECPKQEQDIAFLIDGSGSISPSDFATMISF
VRAVMSQFQRPSTQFSLMQFSHKFWIHFTFNEFVRSPYPLSLLNSVRQLRGFTHTATAIR
MVINELFSARSGARKDATKILIVITDGQKEGDHLDYKDVIPMAEAAGVIRYAIGVGLAFQ
KSHSWKELNDIASKPSQEYIFRVNNFDALKDIQNQLKEKIFAIEGTETKSGSSFEWEMAQ
EGFSAVFTPDGPVLGAVGSFSWSGGAFLYQPNKNPTFLNMSEERVDMRDSYLGYSTELAL
WKGEQNLVLGAPRYQHTGKVVIFTPGPKQWRLKAEVTGTQTGSYFGASLCSMDVNRDGNT
DLVLIGAPHFYEQTQGGRVSVCPLPKVQGRWQCVGVLRGEPGHPWGRFGAALTVLGDVNG
DKLADMVMGARIPIEKEKAPLPKAFQSPPRDSLFPLCQRVAGSQLSPRLQYFGQSLSGGQ
DLTEDGLVDLAVGAQGHALLLRTRPVLQVWMSIRFTPPEIPRSVYECQEQVAPVRTLGDA
TVCLHIYKSSKNRLSDLQSSVTFDLALDPGRPSSRAVFKETNTRTLSRARDLGLTQYCEA
VPLLLPACVEDSMTPIIMRLNFSLEGKQIPSFGKLRPMLDVNSQRYLTASLPFEKNCGDD
RVCQDDLSISFDFSGLNTLLVGSNLELNVAVALRNDGEDSYRTTVTFSYPAGLSYRRVTE
GQNQLQLHSPRLTCDSVPAGSQDTWTTSCSSNHLIFRGGAQITFLATFDVSPRAVLGDRL
LLTANVSSDNNTPRTSKTTFQLELPVKYTVYTVISSHEQSTKYLNFSASEKQQSSVAQHR
YQVNNLGQRDLPVSIYFWVPMELHQEPVWMQVEVSCPQNPSMQCSSERIAPPESDFLNHI
QKNAVLDCSIAACLRLRCDIPSFGVQEELDFVLKGNLSFGWVSQTLQKKVSLVSVAEITF
DRSVYAQLPGQEAFLRAQTETVLEEYKVHNPIPLIAGSSVGGLLLLALITATLYKVGFFK
RQYKEMMQEENQQIVPGNEAQIPEPPSEEQPPGSSDLLFPARLPDSHSHRSQAQERRNTP
RGGAGIRPLSLGERSASDSGSCCLGRALCLVKVPTGHPQAGVPALPPED
NT seq 3750 nt   +upstreamnt  +downstreamnt
atgtctgaccttcccatcatgaccgggaccaggacagccctcctcctgttaatggcctca
gctgcttctctctgcttcaacttggacacggagcagccaactaccttccaagtggacagt
gccgggtttggacacagcgtggtccagtatgccaacaccgggctggtggttggagccccc
cgagagatacaggccgccaaccaaacaggtggcctgtaccagtgtgactaccgcacaagc
aggtgtcagcccatccatctccaagtccccccggaagctgtgaacatgtccctgggcctg
tccctggcagcttccaccaacccttcccagctgttggcctgcggccccactgtgcaccat
gcatgcagggagaacgtgcatttgactggactctgcttcctgctcacttcttccttcagg
tggacccagaggttcccagcagccctgcaggagtgcccaaagcaggagcaggacatcgcg
ttcctgatcgacggctcgggcagcatctcccccagcgattttgccaccatgataagcttc
gtgagggccgtgatgagtcagttccagaggcccagcacacagttctccctgatgcagttc
tcccacaaattctggatacacttcactttcaacgagttcgtccgcagcccctacccgcta
agcctgttaaattctgtgcggcagctgagggggttcactcacacagccacggccatccgc
atggtcataaacgaactgttcagtgccagaagtggggcccgcaaggatgccaccaagatc
ctcattgtcattaccgatgggcagaaagaaggcgaccacctggattataaggacgtcatc
cccatggcggaggcagccggagttatccgctatgccatcggggttgggttggcttttcaa
aagtcacattcctggaaagaattgaacgacattgcatcgaagccctcccaagaatatata
tttagagtgaacaactttgatgctttgaaagatattcaaaaccaactgaaggagaagatt
tttgccattgagggtacggagaccaagagcggtagttcctttgagtgggagatggcccag
gagggcttcagcgccgtgttcacccctgatggaccagttctgggggctgtggggagcttc
agctggtccggaggggcctttctgtaccaaccaaacaagaaccccaccttcctgaacatg
tctgaggagcgcgtggacatgagggactcttacctgggttactccacggagctggccctt
tggaagggggagcagaacctggtcctgggcgccccccgctaccagcacacggggaaggtt
gtcatcttcacccctgggcccaagcagtggaggctgaaggccgaagtcacaggaacccag
actggctcctacttcggggcctccctctgctccatggacgtgaacagagacggcaacacg
gacctggtcctcatcggggccccccacttctatgagcagacccaagggggccgggtgtcc
gtgtgccctctgcccaaggtgcagggaaggtggcagtgtgtgggcgttctccgtggagag
ccgggccacccctggggccgctttggggcagctctgacagtgctgggggacgtgaatggg
gacaagctggctgacatggtaatgggtgcaaggatcccgatagagaaggagaaagcccct
ctccccaaggctttccagtcacctccccgtgactcacttttccctctctgccagcgggtc
gcaggctcccagctctcccccaggctccagtatttcgggcagtcgctgagcgggggtcag
gacctcaccgaggatggcctggtggacctggccgtgggggcccaggggcacgcgctgctg
ctcaggaccagacctgtcctccaggtgtggatgagcatccgcttcacacccccggagatc
cccaggtctgtgtatgagtgtcaggagcaagtggcccctgtccggacactgggcgacgcc
actgtctgccttcatatttacaaaagttccaagaaccgactgagtgacctccagagctct
gtgacttttgatctggccctcgaccctggccgcccgagttcccgtgccgtctttaaggag
acaaacacccggactctgagtcgagcccgagacctggggctgacccaatactgcgaggct
gtgccactgctcctcccggcctgcgtggaggactccatgacccccatcatcatgcgtctc
aacttctccctagagggcaagcagatcccctcctttgggaagctccggcctatgctggac
gtgaattcgcagagatatctcacggcctctctccccttcgagaagaactgcggggacgac
cgcgtctgccaggacgaccttagcatctcctttgacttctcaggcttgaacaccctgttg
gtggggagtaacctggagctgaacgtggccgtggccctgcggaatgatggcgaagactcc
taccgaaccacggtcaccttctcctacccagcagggctgtcctaccgacgcgtgacagag
ggtcagaaccagctgcagctgcactccccacgcctgacgtgtgacagcgtgccagctggg
agccaggacacctggaccaccagctgtagcagcaaccacctcatcttccgtgggggcgcc
cagatcaccttcttggctacctttgatgtctcccccagggctgtgctgggagaccggctg
cttctgacagccaatgtgagcagtgacaataacacgcctaggaccagcaagaccaccttc
cagctggagctcccagtgaagtacaccgtctacactgtgatcagcagccatgagcaatcc
accaagtacctcaacttctccgcctcagagaagcagcagagcagtgtggcccagcacaga
tatcaggtgaacaacctgggtcagcgggacctgcccgtcagcatctacttctgggtgccc
atggagctgcaccaggagccagtgtggatgcaggtggaagtctcctgcccccagaacccg
tccatgcagtgctcttcagagagaatagctcccccagagtccgacttcctgaatcacatt
cagaagaatgctgtgctggactgttcgatcgctgcctgcctgaggctccgctgtgacatc
ccatcctttggcgtccaggaggaactcgacttcgtcctgaagggcaacctcagctttggc
tgggtcagccagacactgcagaagaaggtgtcactggtgagtgtggctgaaatcacgttc
gacagatccgtgtacgcccagcttcctggacaggaggcatttctgagagcccagacggag
acggtgctggaagaatataaggtgcacaaccccatccccctcatcgcgggcagctcagtg
ggaggtctgctgctgctggctctcatcacagccacgctgtacaaggttggcttcttcaaa
cgtcagtacaaggaaatgatgcaggaagaaaaccaacagattgtcccaggaaatgaggca
cagatccccgagccgcccagtgaggaacaacctcctggctcttcggatctgctcttccca
gccaggcttcctgactctcactctcaccgcagtcaggcccaagagagaagaaacactccg
cgtgggggggctgggatcaggccgctttctctgggagaacgcagtgcgtctgacagtggg
tcttgctgcctgggaagggccttgtgtcttgtcaaggttccaactggacaccctcaggct
ggggtccctgccctgcccccagaggactag

DBGET integrated database retrieval system