Tupaia chinensis (Chinese tree shrew): 102483537 Help Entry 102483537         CDS       T02978                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04081   Hormone signaling tup04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     102483537 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     102483537 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102483537 (GAST) Cytokines and neuropeptides [BR:tup04052]  Neuropeptides   GPCR binding    102483537 (GAST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  102483537 NCBI-ProteinID:  XP_006156046 UniProt:  L9K0I6 LinkDB All DBs Position Un AA seq 100 aa AA seqDB search MQRLCAYALILALALAGAEASWKPRAPPQDEPSGLAAHREPHWLNQLGPAAHHRRQLGLQ GPPQPVADLSKKQGPWLEEEEAYGWMDFGRRSAEEGDQRP NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgcagcgactgtgcgcctacgcgctgatccttgctctggctctggccggtgcagaagcg tcttggaagccccgcgccccaccgcaggacgagccgtcgggtctggcggcccacagggag ccgcactggctgaaccagctgggcccagctgctcaccaccgaaggcagctgggactccag ggtcccccacagcccgtggcagacctctccaagaagcaggggccgtggctggaggaagaa gaggcatacggatggatggacttcggccgccgcagtgccgaggaaggggatcaacgccct tag

DBGET integrated database retrieval system