Tupaia chinensis (Chinese tree shrew): 102484753 Help Entry 102484753         CDS       T02978                                  Symbol CLDN7, Claudin-7 Name (RefSeq) claudin 7   KO K06087   claudin Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup03272   Virion - Hepatitis viruses tup04382   Cornified envelope formation tup04514   Cell adhesion molecules tup04530   Tight junction tup04670   Leukocyte transendothelial migration tup05160   Hepatitis C Brite KEGG Orthology (KO) [BR:tup00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     102484753 (CLDN7)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102484753 (CLDN7)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102484753 (CLDN7)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102484753 (CLDN7)   09158 Development and regeneration    04382 Cornified envelope formation     102484753 (CLDN7)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     102484753 (CLDN7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:tup03037]     102484753 (CLDN7)    04147 Exosome [BR:tup04147]     102484753 (CLDN7) Cilium and associated proteins [BR:tup03037]  Other cilia and associated proteins   Stereociliary proteins    102484753 (CLDN7) Exosome [BR:tup04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102484753 (CLDN7)   Exosomal proteins of colorectal cancer cells    102484753 (CLDN7) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 HemY_N Clc-like OppC_N Motif Other DBs NCBI-GeneID:  102484753 NCBI-ProteinID:  XP_006151888 UniProt:  L9KLK4 LinkDB All DBs Position Un AA seq 211 aa AA seqDB search MANSGLQLLGFSLALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTG MMSCKMYDSVLSLPAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAM TGGIIFIVAGLAALVACSWYGHQIVTDFYNPLIPTNMKYEFGPAIFIGWAGSALVLLGGA LLSCSCPGSESKSGYRAPRSYPKPNSAKEYV NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggccaattcgggcctgcagttgctgggtttttccctggctctgctgggctgggtgggc ctggtggcctgcaccgccatcccacagtggcagatgagttcctacgccggcgacaacatc atcacggcccaggccatgtacaaggggctctggatggactgcgtcacgcagagcaccggc atgatgagctgcaaaatgtacgactcggtgctctccctgcccgcggcgctgcaggccact cgagccctaatggtggtatctttggtgctgggcttcctggccatgtttgtggccaccatg ggcatgaagtgcacccgctgtgggggggatgacaaagtgaagaaggctcgaatagccatg acaggaggcatcattttcatcgtggcaggtcttgctgccttggtagcttgctcctggtat ggccatcagattgtcacagacttttataaccccttgatcccgacaaatatgaagtacgag tttggccctgccatctttattggctgggcagggtctgctctggttctcctgggaggtgca ctactctcttgctcctgtcctgggagtgagagcaaaagtgggtaccgggcaccccgctcc taccccaagcctaactctgccaaggagtacgtgtga

DBGET integrated database retrieval system