Tupaia chinensis (Chinese tree shrew): 102485402 Help Entry 102485402         CDS       T02978                                  Name (RefSeq) uncharacterized LOC102485402   KO K10785   T-cell receptor beta chain V region Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04014   Ras signaling pathway tup04015   Rap1 signaling pathway tup04020   Calcium signaling pathway tup04064   NF-kappa B signaling pathway tup04514   Cell adhesion molecules tup04612   Antigen processing and presentation tup04658   Th1 and Th2 cell differentiation tup04659   Th17 cell differentiation tup04660   T cell receptor signaling pathway tup04672   Intestinal immune network for IgA production tup04940   Type I diabetes mellitus tup05135   Yersinia infection tup05142   Chagas disease tup05144   Malaria tup05150   Staphylococcus aureus infection tup05162   Measles tup05166   Human T-cell leukemia virus 1 infection tup05169   Epstein-Barr virus infection tup05170   Human immunodeficiency virus 1 infection tup05202   Transcriptional misregulation in cancer tup05235   PD-L1 expression and PD-1 checkpoint pathway in cancer tup05310   Asthma tup05320   Autoimmune thyroid disease tup05321   Inflammatory bowel disease tup05322   Systemic lupus erythematosus tup05323   Rheumatoid arthritis tup05330   Allograft rejection tup05332   Graft-versus-host disease tup05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102485402    04015 Rap1 signaling pathway     102485402    04064 NF-kappa B signaling pathway     102485402    04020 Calcium signaling pathway     102485402   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102485402  09150 Organismal Systems   09151 Immune system    04612 Antigen processing and presentation     102485402    04660 T cell receptor signaling pathway     102485402    04658 Th1 and Th2 cell differentiation     102485402    04659 Th17 cell differentiation     102485402    04672 Intestinal immune network for IgA production     102485402  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102485402    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102485402   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102485402    05170 Human immunodeficiency virus 1 infection     102485402    05162 Measles     102485402    05169 Epstein-Barr virus infection     102485402   09171 Infectious disease: bacterial    05135 Yersinia infection     102485402    05150 Staphylococcus aureus infection     102485402   09174 Infectious disease: parasitic    05144 Malaria     102485402    05142 Chagas disease     102485402   09163 Immune disease    05310 Asthma     102485402    05322 Systemic lupus erythematosus     102485402    05323 Rheumatoid arthritis     102485402    05320 Autoimmune thyroid disease     102485402    05321 Inflammatory bowel disease     102485402    05330 Allograft rejection     102485402    05332 Graft-versus-host disease     102485402   09166 Cardiovascular disease    05416 Viral myocarditis     102485402   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102485402 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  V-set Ig_3 I-set Ig_2 Motif Other DBs NCBI-GeneID:  102485402 NCBI-ProteinID:  XP_006145167 LinkDB All DBs Position Un AA seq 236 aa AA seqDB search MVTRLLCWVALCLLGSGDADTGVSQSPKYRITVRGQNVTLWCDPISGHAVLYWYRQTLGQ SPEYLLYFQNNFMSDNSGLPSDRFSAERAGGSSSTLRIQPAEAGDSALYLCASSLATVGH CPLLPAHKPSCAQLSPQFSEALAKELPWSCRIKGQKRIWDFKCSSDKRNGCFMPTSPPKS KDEFEAENTNQPVLFCALEDPDTFFGTASAKDHELQPAWAEASLESTFDEDWEGLP NT seq 711 nt NT seq  +upstreamnt  +downstreamnt atggtcaccaggctcctctgctgggtggccctctgcctcctggggtcaggtgatgcagat actggagtatcccagtcccctaaatacaggatcacagtgaggggacagaatgtaactctt tggtgtgatccaatttccggtcatgctgtcctttattggtaccgacagactctgggacag agcccagagtatttgctttatttccagaacaatttcatgtcagacaattctggtctgccc agcgaccgcttctctgctgagagggctgggggctcgtcctccactctgagaatccagccc gcagaggcgggggactcggccctgtatctctgtgccagcagcttagccacagtggggcac tgtcccctccttcctgctcacaaaccctcctgtgctcagctctccccacagttctcagaa gctctggccaaggagctgccctggtcttgccgcatcaaagggcagaaacgcatttgggac ttcaagtgctcttctgataagagaaatggctgtttcatgcctacctcaccaccaaaatcg aaagatgaatttgaggctgaaaacacaaatcagccagtgctgttctgtgccctggaagac cctgacaccttctttgggacagcctcagcaaaggaccatgaactgcagcctgcatgggca gaggcttctctggagtctacatttgatgaagactgggaaggtcttccatga

DBGET integrated database retrieval system