Tupaia chinensis (Chinese tree shrew): 102486553 Help Entry 102486553         CDS       T02978                                  Symbol CAV1 Name (RefSeq) caveolin 1   KO K06278   caveolin 1 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04144   Endocytosis tup04510   Focal adhesion tup05020   Prion disease tup05100   Bacterial invasion of epithelial cells tup05205   Proteoglycans in cancer tup05416   Viral myocarditis tup05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tup00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102486553 (CAV1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102486553 (CAV1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102486553 (CAV1)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     102486553 (CAV1)   09164 Neurodegenerative disease    05020 Prion disease     102486553 (CAV1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102486553 (CAV1)    05416 Viral myocarditis     102486553 (CAV1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tup04131]     102486553 (CAV1) Membrane trafficking [BR:tup04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     102486553 (CAV1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  102486553 NCBI-ProteinID:  XP_006162440 LinkDB All DBs Position Un Genome browser AA seq 178 aa AA seqDB search MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVNEKQVYDAHTKEIDLVNRDPKHLN DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSGLFGIPMALIWGIYFA ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPFFEAVGKIFSNIRVNMQKEI NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgtctgggggcaaatacgtagattccgagggacatctctacactgttcccatccgggaa cagggcaacatctacaagcccaacaacaaggccatggcagacgaggtgaatgagaagcaa gtgtatgacgcgcacaccaaggagatcgacctggtcaaccgcgaccccaagcatctcaat gacgacgtggttaagattgacttcgaagatgtgattgcagaaccagaaggaactcacagt tttgacggcatctggaaggccagcttcaccaccttcacagtgacgaagtactggttttac cgcttactgtctggcctctttggcattccaatggcactcatctggggcatttactttgcc atcctctctttcctgcacatctgggcagtggtaccatgcattaagagcttcctgattgag attcagtgcatcagccgtgtctattccatctacgtccacaccttctgtgacccattcttt gaagctgttggtaaaatcttcagcaacatccgtgtcaacatgcagaaagaaatatga

DBGET integrated database retrieval system