Tupaia chinensis (Chinese tree shrew): 102486626 Help Entry 102486626         CDS       T02978                                  Symbol BCL2L1 Name (RefSeq) BCL2 like 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup01521   EGFR tyrosine kinase inhibitor resistance tup01524   Platinum drug resistance tup04014   Ras signaling pathway tup04064   NF-kappa B signaling pathway tup04115   p53 signaling pathway tup04137   Mitophagy - animal tup04140   Autophagy - animal tup04151   PI3K-Akt signaling pathway tup04210   Apoptosis tup04215   Apoptosis - multiple species tup04621   NOD-like receptor signaling pathway tup04630   JAK-STAT signaling pathway tup05012   Parkinson disease tup05014   Amyotrophic lateral sclerosis tup05022   Pathways of neurodegeneration - multiple diseases tup05145   Toxoplasmosis tup05162   Measles tup05166   Human T-cell leukemia virus 1 infection tup05168   Herpes simplex virus 1 infection tup05170   Human immunodeficiency virus 1 infection tup05200   Pathways in cancer tup05202   Transcriptional misregulation in cancer tup05212   Pancreatic cancer tup05220   Chronic myeloid leukemia tup05222   Small cell lung cancer tup05225   Hepatocellular carcinoma tup05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102486626 (BCL2L1)    04630 JAK-STAT signaling pathway     102486626 (BCL2L1)    04064 NF-kappa B signaling pathway     102486626 (BCL2L1)    04151 PI3K-Akt signaling pathway     102486626 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102486626 (BCL2L1)    04137 Mitophagy - animal     102486626 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     102486626 (BCL2L1)    04215 Apoptosis - multiple species     102486626 (BCL2L1)    04115 p53 signaling pathway     102486626 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102486626 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102486626 (BCL2L1)    05202 Transcriptional misregulation in cancer     102486626 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     102486626 (BCL2L1)    05225 Hepatocellular carcinoma     102486626 (BCL2L1)    05220 Chronic myeloid leukemia     102486626 (BCL2L1)    05222 Small cell lung cancer     102486626 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102486626 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     102486626 (BCL2L1)    05162 Measles     102486626 (BCL2L1)    05168 Herpes simplex virus 1 infection     102486626 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102486626 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     102486626 (BCL2L1)    05014 Amyotrophic lateral sclerosis     102486626 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     102486626 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102486626 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102486626 (BCL2L1)    01524 Platinum drug resistance     102486626 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:tup01009]     102486626 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tup03036]     102486626 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:tup02000]     102486626 (BCL2L1) Protein phosphatases and associated proteins [BR:tup01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      102486626 (BCL2L1) Chromosome and associated proteins [BR:tup03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     102486626 (BCL2L1) Transporters [BR:tup02000]  Other transporters   Pores ion channels [TC:1]    102486626 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  102486626 NCBI-ProteinID:  XP_006154781 LinkDB All DBs Position Un AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEASEGAESELETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITLGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaatcgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagaaaacaggactgaggcctcagaaggg gctgaatcagagctggagacccccagtgccatcaatggcaacccatcctggcatctggcg gacagtcctgcggtgaatggagccactggccacagcagcagcttggatgctcgggaggtg atccccatggcagcagtgaagcaagcactgagggaagccggcgacgagtttgaactgcgg taccggcgggcattcagtgacctgacatcccagctccacatcaccctagggacagcatat cagagctttgaacaggtagtgaacgaactcttccgggatggggtaaactggggtcgcatt gtggcctttttctccttcggcggggccctgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg gccggcgtggttctgctgggctcgctcttcagccggaaatga

DBGET integrated database retrieval system