Tupaia chinensis (Chinese tree shrew): 102487524 Help Entry 102487524         CDS       T02978                                  Name (RefSeq) metallothionein-1E   KO K14739   metallothionein 1/2 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04978   Mineral absorption Brite KEGG Orthology (KO) [BR:tup00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     102487524  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tup03019]     102487524    03029 Mitochondrial biogenesis [BR:tup03029]     102487524 Messenger RNA biogenesis [BR:tup03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      102487524 Mitochondrial biogenesis [BR:tup03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     102487524 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  102487524 NCBI-ProteinID:  XP_006148460 UniProt:  L9KTN7 LinkDB All DBs Position Un AA seq 61 aa AA seqDB search MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgcgccactggtggctcctgcacctgcgctggctcctgcaaa tgcaaagaatgcaagtgcacctcctgcaagaagagctgctgctcctgctgccctgtgggc tgtgccaagtgtgcccagggctgtgtctgcaaaggggcctcagacaagtgtagctgctgt gcctga

DBGET integrated database retrieval system