Tupaia chinensis (Chinese tree shrew): 102491547 Help Entry 102491547         CDS       T02978                                  Symbol FKBP1A Name (RefSeq) FK506 binding protein 1A   KO K09568   FK506-binding protein 1 [EC:5.2.1.8] Organism tup  Tupaia chinensis (Chinese tree shrew) Brite KEGG Orthology (KO) [BR:tup00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:tup03110]     102491547 (FKBP1A) Enzymes [BR:tup01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      102491547 (FKBP1A) Chaperones and folding catalysts [BR:tup03110]  Protein folding catalysts   Peptidyl prolyl isomerase    FKBP     102491547 (FKBP1A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FKBP_C Motif Other DBs NCBI-GeneID:  102491547 NCBI-ProteinID:  XP_014448768 LinkDB All DBs Position Un AA seq 91 aa AA seqDB search MPTARMRKPRRGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLII SPDYAYGATGHPGIIPPHATLIFDVELLKLE NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgcccactgcacggatgaggaaaccgaggcgagggatgcttgaagatggaaagaaattt gattcttcccgggacagaaacaagccctttaagtttatgctgggcaaacaggaggtgatc cgaggctgggaagaaggggttgcccagatgagtgtgggccagcgagccaaattgatcatc tccccagactatgcctacggtgcaactgggcacccaggcatcatcccaccacacgccact ctcatcttcgacgtggaacttctaaaactggaatga

DBGET integrated database retrieval system