Tupaia chinensis (Chinese tree shrew): 102491716 Help Entry 102491716         CDS       T02978                                  Symbol MYL7 Name (RefSeq) myosin light chain 7   KO K12754   myosin regulatory light chain 7 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04510   Focal adhesion tup04520   Adherens junction tup04670   Leukocyte transendothelial migration tup04810   Regulation of actin cytoskeleton tup04814   Motor proteins tup04820   Cytoskeleton in muscle cells tup05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tup00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     102491716 (MYL7)    04520 Adherens junction     102491716 (MYL7)   09142 Cell motility    04814 Motor proteins     102491716 (MYL7)    04820 Cytoskeleton in muscle cells     102491716 (MYL7)    04810 Regulation of actin cytoskeleton     102491716 (MYL7)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102491716 (MYL7)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102491716 (MYL7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:tup04812]     102491716 (MYL7) Cytoskeleton proteins [BR:tup04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      102491716 (MYL7) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 CHCH EF_EFCAB10_C EF-hand_9 Motif Other DBs NCBI-GeneID:  102491716 NCBI-ProteinID:  XP_006166076 LinkDB All DBs Position Un AA seq 175 aa AA seqDB search MASRKASTRGKAAASKQAQRASSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKSDLRET YCQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEDAILSAFRMFDPSGTG VVNKDEFKQLLLTQADKFSLAEVEQMFALTPVDLAGNIDYKSLCYIITHGDEKEE NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggctagtcgaaaggcaagcactcggggcaaggctgcagcctccaagcaggcccagcgc gcctcatccaacgtgttctccatgtttgagcaagcccagatccaggagttcaaggaggcc ttcagctgcatcgaccagaaccgtgatggcatcatctgcaagtcagacctgcgagagacc tactgccagctggggaaggtgagtgtcccggaggaggagctggatgccatgctgcaggag ggcaaaggccccatcaacttcactgtgttcctcacactctttggcgagaagctcaatggg acagaccctgaggatgccatcctgagcgccttccgcatgttcgaccccagcggcactggg gtggtgaataaggacgagttcaagcagctgctcctgacacaggcagacaagttctctcta gcagaggtggagcagatgtttgccctgacacctgtggacctggcgggaaatatcgactac aagtccctgtgctacatcatcacccatggggacgagaaagaggagtga

DBGET integrated database retrieval system