KEGG   Tupaia chinensis (Chinese tree shrew): 102493041
Entry
102493041         CDS       T02978                                 
Symbol
CALM3, Calmodulin
Name
(RefSeq) calmodulin 3
  KO
K02183  calmodulin
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04070  Phosphatidylinositol signaling system
tup04114  Oocyte meiosis
tup04218  Cellular senescence
tup04261  Adrenergic signaling in cardiomyocytes
tup04270  Vascular smooth muscle contraction
tup04371  Apelin signaling pathway
tup04625  C-type lectin receptor signaling pathway
tup04713  Circadian entrainment
tup04720  Long-term potentiation
tup04722  Neurotrophin signaling pathway
tup04728  Dopaminergic synapse
tup04740  Olfactory transduction
tup04744  Phototransduction
tup04750  Inflammatory mediator regulation of TRP channels
tup04910  Insulin signaling pathway
tup04912  GnRH signaling pathway
tup04915  Estrogen signaling pathway
tup04916  Melanogenesis
tup04921  Oxytocin signaling pathway
tup04922  Glucagon signaling pathway
tup04924  Renin secretion
tup04925  Aldosterone synthesis and secretion
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup05010  Alzheimer disease
tup05012  Parkinson disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05031  Amphetamine addiction
tup05034  Alcoholism
tup05133  Pertussis
tup05152  Tuberculosis
tup05163  Human cytomegalovirus infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05170  Human immunodeficiency virus 1 infection
tup05200  Pathways in cancer
tup05214  Glioma
tup05417  Lipid and atherosclerosis
tup05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102493041 (CALM3)
   04015 Rap1 signaling pathway
    102493041 (CALM3)
   04371 Apelin signaling pathway
    102493041 (CALM3)
   04020 Calcium signaling pathway
    102493041 (CALM3)
   04070 Phosphatidylinositol signaling system
    102493041 (CALM3)
   04024 cAMP signaling pathway
    102493041 (CALM3)
   04022 cGMP-PKG signaling pathway
    102493041 (CALM3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102493041 (CALM3)
   04218 Cellular senescence
    102493041 (CALM3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102493041 (CALM3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102493041 (CALM3)
   04922 Glucagon signaling pathway
    102493041 (CALM3)
   04912 GnRH signaling pathway
    102493041 (CALM3)
   04915 Estrogen signaling pathway
    102493041 (CALM3)
   04921 Oxytocin signaling pathway
    102493041 (CALM3)
   04916 Melanogenesis
    102493041 (CALM3)
   04924 Renin secretion
    102493041 (CALM3)
   04925 Aldosterone synthesis and secretion
    102493041 (CALM3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102493041 (CALM3)
   04270 Vascular smooth muscle contraction
    102493041 (CALM3)
  09154 Digestive system
   04970 Salivary secretion
    102493041 (CALM3)
   04971 Gastric acid secretion
    102493041 (CALM3)
  09156 Nervous system
   04728 Dopaminergic synapse
    102493041 (CALM3)
   04720 Long-term potentiation
    102493041 (CALM3)
   04722 Neurotrophin signaling pathway
    102493041 (CALM3)
  09157 Sensory system
   04744 Phototransduction
    102493041 (CALM3)
   04740 Olfactory transduction
    102493041 (CALM3)
   04750 Inflammatory mediator regulation of TRP channels
    102493041 (CALM3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102493041 (CALM3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102493041 (CALM3)
  09162 Cancer: specific types
   05214 Glioma
    102493041 (CALM3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102493041 (CALM3)
   05163 Human cytomegalovirus infection
    102493041 (CALM3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102493041 (CALM3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102493041 (CALM3)
   05152 Tuberculosis
    102493041 (CALM3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102493041 (CALM3)
   05012 Parkinson disease
    102493041 (CALM3)
   05022 Pathways of neurodegeneration - multiple diseases
    102493041 (CALM3)
  09165 Substance dependence
   05031 Amphetamine addiction
    102493041 (CALM3)
   05034 Alcoholism
    102493041 (CALM3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102493041 (CALM3)
   05418 Fluid shear stress and atherosclerosis
    102493041 (CALM3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tup01009]
    102493041 (CALM3)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102493041 (CALM3)
   03036 Chromosome and associated proteins [BR:tup03036]
    102493041 (CALM3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tup04147]
    102493041 (CALM3)
Protein phosphatases and associated proteins [BR:tup01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     102493041 (CALM3)
Membrane trafficking [BR:tup04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    102493041 (CALM3)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     102493041 (CALM3)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102493041 (CALM3)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EH EF-hand_11 EFhand_Ca_insen EF_EFCAB10_C EF-hand_EFHB_C UPF0154 SPARC_Ca_bdg DUF1103 DUF5580_M Dockerin_1 EF-hand_STIM1 SAPC2_N FCaBP_EF-hand SPEF2_C SurA_N_3 Poly_export
Other DBs
NCBI-GeneID: 102493041
NCBI-ProteinID: XP_006142163
LinkDB
Position
Un
AA seq 113 aa
MRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKD
GNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
NT seq 342 nt   +upstreamnt  +downstreamnt
atgagatccctgggacagaaccccactgaagcggagctgcaggacatgatcaacgaggtg
gatgcggatgggaacgggaccattgacttcccggagttcctgaccatgatggcccgaaag
atgaaggacacggacagcgaggaggagatccgagaggcgttccgcgtctttgacaaggac
gggaacggctacatcagcgccgcggagctgcgtcacgtcatgacgaacctgggggagaag
ctgacggacgaggaggtggacgagatgatcagagaggccgacatcgatggggacggccag
gtcaactatgaagagttcgtacagatgatgaccgccaagtga

DBGET integrated database retrieval system