Tupaia chinensis (Chinese tree shrew): 102493627 Help Entry 102493627         CDS       T02978                                  Symbol IL12A Name (RefSeq) interleukin 12A   KO K05406   interleukin 12A Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04060   Cytokine-cytokine receptor interaction tup04620   Toll-like receptor signaling pathway tup04622   RIG-I-like receptor signaling pathway tup04625   C-type lectin receptor signaling pathway tup04630   JAK-STAT signaling pathway tup04658   Th1 and Th2 cell differentiation tup04936   Alcoholic liver disease tup04940   Type I diabetes mellitus tup05133   Pertussis tup05134   Legionellosis tup05140   Leishmaniasis tup05142   Chagas disease tup05143   African trypanosomiasis tup05144   Malaria tup05145   Toxoplasmosis tup05146   Amoebiasis tup05152   Tuberculosis tup05162   Measles tup05164   Influenza A tup05168   Herpes simplex virus 1 infection tup05171   Coronavirus disease - COVID-19 tup05200   Pathways in cancer tup05321   Inflammatory bowel disease tup05330   Allograft rejection tup05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102493627 (IL12A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102493627 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102493627 (IL12A)    04622 RIG-I-like receptor signaling pathway     102493627 (IL12A)    04625 C-type lectin receptor signaling pathway     102493627 (IL12A)    04658 Th1 and Th2 cell differentiation     102493627 (IL12A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102493627 (IL12A)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     102493627 (IL12A)    05164 Influenza A     102493627 (IL12A)    05162 Measles     102493627 (IL12A)    05168 Herpes simplex virus 1 infection     102493627 (IL12A)   09171 Infectious disease: bacterial    05133 Pertussis     102493627 (IL12A)    05134 Legionellosis     102493627 (IL12A)    05152 Tuberculosis     102493627 (IL12A)   09174 Infectious disease: parasitic    05146 Amoebiasis     102493627 (IL12A)    05144 Malaria     102493627 (IL12A)    05145 Toxoplasmosis     102493627 (IL12A)    05140 Leishmaniasis     102493627 (IL12A)    05142 Chagas disease     102493627 (IL12A)    05143 African trypanosomiasis     102493627 (IL12A)   09163 Immune disease    05321 Inflammatory bowel disease     102493627 (IL12A)    05330 Allograft rejection     102493627 (IL12A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102493627 (IL12A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102493627 (IL12A)    04936 Alcoholic liver disease     102493627 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102493627 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:tup00536]     102493627 (IL12A) Cytokines and neuropeptides [BR:tup04052]  Cytokines   Interleukins    102493627 (IL12A) Glycosaminoglycan binding proteins [BR:tup00536]  Heparan sulfate / Heparin   Cytokines    102493627 (IL12A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL12 ATP-synt_Z Motif Other DBs NCBI-GeneID:  102493627 NCBI-ProteinID:  XP_006163109 LinkDB All DBs Position Un AA seq 247 aa AA seqDB search SASQPPPSPARRTGPQPAVPLRARHVCPAQXVTSLLLAATLVLLHHGTLARNLPTAMPGP GKFGCLSHSQNLLTAISNTLQKARKNLEFYSCTSEEIDHEDITKDKTSTVKACLPLELIT NESCLASRETSFKTNGSCLAPEKTSHMMTLCLSSIYEDLKMYQVEFKAINAQLWMDPERQ ILLDQNMLTAIDELMQALNFNSDTVPRSYSLEEPDFYKTKIKLCILLHAFRVRAVTIDRV MSYLNTS NT seq 744 nt NT seq  +upstreamnt  +downstreamnt tcagcctcccagccaccgccctcacctgctcggcgcaccggtcctcagcccgccgtcccg ctcagagcccggcatgtgtgccccgcgcagtgagtaaccagcctcctcctggcagccacc cttgtcctcctgcaccatggcactttggccaggaaccttcctacggccatgccaggccca ggcaagtttggatgccttagccactcccagaacctgctgaccgccatcagcaacactctt cagaaggccagaaaaaacctagaattttactcctgtacttccgaagagattgatcatgaa gatatcacaaaagataaaaccagcacagtgaaggcctgtttacccctggaattaatcacg aatgagagttgcctggcttccagagagacctctttcaaaaccaatgggagttgcctggcc cctgaaaagacctcccatatgatgaccctgtgtcttagtagtatctatgaagacttgaag atgtaccaggtggagttcaaggccataaatgcccagctttggatggatcctgaaaggcag atccttttagatcaaaacatgctgacagctattgatgagctgatgcaggccctgaatttc aacagtgataccgtgccacgaagctactcccttgaagaaccagatttttacaaaactaaa atcaagctctgcatccttctccacgctttcagagtgcgtgcagtgaccattgatagagtg atgagctatctgaatacttcctaa

DBGET integrated database retrieval system