Tupaia chinensis (Chinese tree shrew): 102494255 Help Entry 102494255         CDS       T02978                                  Symbol IL17A Name (RefSeq) interleukin 17A   KO K05489   interleukin 17A Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04060   Cytokine-cytokine receptor interaction tup04657   IL-17 signaling pathway tup04659   Th17 cell differentiation tup04936   Alcoholic liver disease tup05321   Inflammatory bowel disease tup05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102494255 (IL17A)  09150 Organismal Systems   09151 Immune system    04659 Th17 cell differentiation     102494255 (IL17A)    04657 IL-17 signaling pathway     102494255 (IL17A)  09160 Human Diseases   09163 Immune disease    05323 Rheumatoid arthritis     102494255 (IL17A)    05321 Inflammatory bowel disease     102494255 (IL17A)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102494255 (IL17A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102494255 (IL17A) Cytokines and neuropeptides [BR:tup04052]  Cytokines   Interleukins    102494255 (IL17A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL17 Motif Other DBs NCBI-GeneID:  102494255 NCBI-ProteinID:  XP_006170506 LinkDB All DBs Position Un AA seq 153 aa AA seqDB search MSSGRTSSVALLMLLGLVAVVKAGIAVSRNPECPSTEDRNFPQTVNVNMNILNQNTNSKR ASDYYKRSTSPWTLHRNEDPERYPPVIWEAKCRHLGCVDAEGKVNHHMNSVPIQQEILVL RRESQHCPRSFRLEKILVTVGCTCVTPIVRHVV NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgtcttctgggaggacttcatctgtggcactgctaatgctattgggtctggtggctgtg gtgaaggcaggaatagcagtctctcgaaatccagaatgcccaagtactgaggacaggaac ttcccccaaactgtgaacgtcaacatgaacatccttaaccagaatacaaattccaaaaga gcctcagattactacaaacgatccacttcaccttggactctccaccgcaatgaggaccct gagagatatccccctgtgatctgggaggcaaagtgccgccatttgggctgtgtggatgct gaagggaaagtgaaccaccacatgaactctgtccccatccagcaagagatcttggtcctg agaagggaatctcagcactgtccccgctccttccggctggagaagatactggtgactgtg ggctgcacctgtgtcacccctatcgtccgccatgttgtctaa

DBGET integrated database retrieval system