Tupaia chinensis (Chinese tree shrew): 102494762 Help Entry 102494762         CDS       T02978                                  Symbol CFL1, Cofilin-1 Name (RefSeq) cofilin 1   KO K05765   cofilin Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04360   Axon guidance tup04666   Fc gamma R-mediated phagocytosis tup04810   Regulation of actin cytoskeleton tup05133   Pertussis tup05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:tup00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102494762 (CFL1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     102494762 (CFL1)   09158 Development and regeneration    04360 Axon guidance     102494762 (CFL1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102494762 (CFL1)   09171 Infectious disease: bacterial    05133 Pertussis     102494762 (CFL1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tup04131]     102494762 (CFL1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:tup04812]     102494762 (CFL1)    04147 Exosome [BR:tup04147]     102494762 (CFL1) Membrane trafficking [BR:tup04131]  Others   Actin-binding proteins    Others     102494762 (CFL1) Cytoskeleton proteins [BR:tup04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      102494762 (CFL1) Exosome [BR:tup04147]  Exosomal proteins   Proteins found in most exosomes    102494762 (CFL1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  102494762 NCBI-ProteinID:  XP_006149972 UniProt:  L9KVC8 LinkDB All DBs Position Un AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYTTFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPECAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctctggtgtggctgtctctgatggcgtcatcaaggtgttcaacgacatgaaggtg cgcaagtcatcaacaccagaggaggtgaagaagcgcaagaaggcagtactcttctgcctg agtgaggacaagaagaacatcatcctggaggagggcaaggagatcctcgtaggtgacgtg ggccagactgtcgacgacccctacaccacctttgtcaagatgctgccagataaagactgc cgctatgccctctatgatgcgacctatgagaccaaggagagcaagaaggaagacctggtg ttcatcttctgggcccctgagtgtgcaccccttaagagcaaaatgatctatgccagctcc aaggatgccatcaagaagaaactgacagggatcaagcatgaattacaagcaaactgctac gaggaggtcaaggaccgctgcaccctggcagagaagctgggaggcagtgccgtcatctcc ctggagggcaaacctttgtga

DBGET integrated database retrieval system