Tupaia chinensis (Chinese tree shrew): 102494811 Help Entry 102494811         CDS       T02978                                  Symbol CCL26 Name (RefSeq) C-C motif chemokine ligand 26   KO K21096   C-C motif chemokine 26 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04060   Cytokine-cytokine receptor interaction tup04061   Viral protein interaction with cytokine and cytokine receptor tup04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102494811 (CCL26)    04061 Viral protein interaction with cytokine and cytokine receptor     102494811 (CCL26)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     102494811 (CCL26)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102494811 (CCL26) Cytokines and neuropeptides [BR:tup04052]  Cytokines   Chemokines    102494811 (CCL26) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  102494811 NCBI-ProteinID:  XP_006155691 LinkDB All DBs Position Un AA seq 94 aa AA seqDB search MKSFPMILPVLLAVMLSIHLGAPTRGSDMAKSCCFHYNQKMLPFRWVHTYEFTRNSCPKQ GVIFTTKRGKQVCVQPKEKWVQTYIALLRAQKQL NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaagagcttccccatgattcttcctgtcctcctggccgtcatgctgagtatccatctt ggagctcccacacgtggcagtgacatggccaagtcctgctgctttcactacaatcaaaag atgcttccctttcgctgggtgcacacctatgaattcaccaggaacagctgccccaagcag ggtgtgatattcactaccaaaagaggcaagcaagtctgtgtccaaccaaaagaaaaatgg gtgcaaacatacattgcattactgagagctcagaaacagctatga

DBGET integrated database retrieval system